DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ZBTB5 and CG31365

Sequence 1:NP_055687.1 Gene:ZBTB5 HGNCID:23836 Length:677 Species:Homo sapiens
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:598 Identity:111/599 (19%)
Similarity:174/599 (29%) Gaps:253/599 (42%)


Human   134 QEQSARMQRSFMLQQLGLSIVSSALNSSQNGEEQPAPMSSSMRSNLDQRTPFPMRRLHKRKQSAE 198
            :||:|.|.:..:..:|                |..|.:::.:|..|.:..     |...||:.||
  Fly   141 EEQAAEMHKRLVKSRL----------------ELRAKLTTELRKELAEEV-----RSEVRKELAE 184

Human   199 E---RARQRLRPSIDE--------------------------SAISDVTPENGPSGVHSREEFFS 234
            |   :.|..||..:.|                          .::....||..|    ..:|..|
  Fly   185 EVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKP----QVKEDAS 245

Human   235 PDSLK----------IVD-NPKADGM--------------TDNQEDSAIMFDQSFGTQEDAQVPS 274
            |...|          :|| |.||...              ||...:|.:..|   |.:.|.:||:
  Fly   246 PSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNID---GLELDEEVPA 307

Human   275 QS-----------------DNSAGNMAQLSMASRATQVETSFDQEAAPEKSSFQCENPEVGLGEK 322
            :|                 ||  |.:..::.||...|     :|::.||   |..:|.......|
  Fly   308 ESGEDFREINMVGSDVVHTDN--GEIYIINSASSEDQ-----NQDSTPE---FDQDNGITSYNIK 362

Human   323 EHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTD 387
            |                     |...|..|.:..|:|.|||.....::|.|....||.:      
  Fly   363 E---------------------DGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHE------ 400

Human   388 RVGDIHILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNNDDNIPNTTSDCRLESEAPYLLSPEA 452
               ::.|:|...|...:.|     .|.:.|.:.....|               ||..|   .|:.
  Fly   401 ---NVIIVEKEQNDRDEQT-----PLKRKRSSELVFKQ---------------ESSCP---QPKT 439

Human   453 GPAGGPSSAPGSHVENPFSEPADSHFVRPMQ-EVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSS 516
            |.......:...|: .|.:.|......|... .:.||                   :||      
  Fly   440 GRITDTVKSFQCHL-CPVAFPTQKLLTRHHNTHIKGL-------------------KSG------ 478

Human   517 FSRVMIGSPRGGASNFPYYRRIAPKMPVVTSVRSSQIPENSTSSQLMMNGATSSFENGHPSQPGP 581
                     :||....|                       |.:.||                   
  Fly   479 ---------KGGTLKCP-----------------------SCALQL------------------- 492

Human   582 PQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKC 646
                        .|..:|..| :::..|.:.:.|..|..:|......|:|:..|||.|.:.|.:|
  Fly   493 ------------SCASSLKRH-MIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQC 544

Human   647 GKRFSQSSHLYKH 659
            ...|:|.|:|.:|
  Fly   545 SSCFAQKSNLQQH 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZBTB5NP_055687.1 BTB 14..119 CDD:279045
BTB 25..119 CDD:197585
C2H2 Zn finger 615..635 CDD:275368 5/20 (25%)
zf-H2C2_2 627..652 CDD:290200 9/25 (36%)
C2H2 Zn finger 643..662 CDD:275368 7/18 (39%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 23/128 (18%)
RRF <161..222 CDD:294170 12/66 (18%)
zf-C2H2_8 454..530 CDD:292531 22/165 (13%)
C2H2 Zn finger 485..505 CDD:275368 7/75 (9%)
zf-H2C2_2 497..522 CDD:290200 6/26 (23%)
C2H2 Zn finger 513..533 CDD:275368 5/20 (25%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 7/18 (39%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.