DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: EEF1E1 and GstT4

Sequence 1:NP_004271.1 Gene:EEF1E1 HGNCID:3212 Length:174 Species:Homo sapiens
Sequence 2:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster

Alignment Length:203 Identity:44/204 (22%)
Similarity:73/204 (36%) Gaps:71/204 (35%)


Human     9 LLEKS--------LGLSKGNKYSAQGE--------RQIPVLQTNNGPSLTGLTTIAAHLVKQ--- 54
            |||.|        :.:.||...:  ||        |::|.: |::|..|:....|..||.::   
  Fly    22 LLEASKIPFEAIPISMLKGEHLT--GEFRDNVNRFRKLPAI-TDHGYQLSENVAIFRHLAREKLV 83

Human    55 -------------ANKEYL------LGSTAEEKAIVQQWLE---YRVTQVDGH---SSKNDIHTL 94
                         ...|||      :| .|..:...|:||.   .:....|..   :||...|||
  Fly    84 PEHWYPRRHLGRSRIDEYLAWQQTNMG-VATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTL 147

Human    95 LKDLNSYLEDKVYLTGYNFTLADILLY--------YGLHRFIVDLTVQEKEKYLNVSRWFCHIQH 151
            .:....:|..:.::.|.|.:.||:...        .|.:.|      |.:.|   ::||      
  Fly   148 NEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAF------QNRNK---LARW------ 197

Human   152 YPGIRQHL 159
            |..:|:.|
  Fly   198 YETVREEL 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
EEF1E1NP_004271.1 N-terminal 2..56 16/79 (20%)
Linker 57..63 4/12 (33%)
C-terminal 64..152 21/102 (21%)
GST_C_AIMP3 65..165 CDD:198338 24/110 (22%)
GstT4NP_572886.2 GstA 5..203 CDD:223698 43/200 (22%)
GST_N_Theta 5..80 CDD:239348 16/61 (26%)
GST_C_Theta 95..220 CDD:198292 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.