DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCARB2 and santa-maria

DIOPT Version :9

Sequence 1:NP_005497.1 Gene:SCARB2 / 950 HGNCID:1665 Length:478 Species:Homo sapiens
Sequence 2:NP_609121.2 Gene:santa-maria / 34024 FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster


Alignment Length:434 Identity:126/434 - (29%)
Similarity:223/434 - (51%) Gaps:31/434 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    34 DQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGET-PRVEEVGPYTYRELRNK 97
            |..:.|::.|...|..:::|:.||:.:....|.:|.||||:.....| |.:|:||||.:.|..:|
  Fly    42 DWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDFGNLSTKPILEQVGPYRFIERPDK 106

Human    98 ANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVL----TVIEWSQVHFLREIIEA 158
            .:|.:.....:::......:.|:...|.|... |.|.|||...|    |...|..|.  |.:::.
  Fly   107 VDIHWHPENASVTYRRRSLFYFDAAGSNGSLD-DEITTLNAVALSAAATAKYWPPVK--RSLVDV 168

Human   159 MLKAYQQKLFVTHTVDELLW-GYKDEILSL---IHVFRPDIS-PY--FGLFYEKNGTND--GDYV 214
            .||.|..::.|..::||||: ||.|.::.:   :.:|..::. |:  ||.||.:||:.|  |.:.
  Fly   169 GLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEVKVPFDKFGWFYTRNGSADLTGVFN 233

Human   215 FLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITK-DEVLYVFPSDFCRSVY 278
            ..||.|......::..||.:.:..:: ...|.|.||:.|: |.|...| .:.:.:|..|.||::.
  Fly   234 VFTGADQLAKLGQMHSWNYQENTGFF-DSYCGMTNGSAGE-FQPQHLKPGDSVGLFTPDMCRTIP 296

Human   279 ITFSDYESVQGLPAFRYK-VPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHF 342
            :.:.:...::||..:::. .|..:...|......|...|.|:.|||:|:|.|:.|:|:.||:|||
  Fly   297 LDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFCGGQCVPSGVMNISSCRFGSPVFMSYPHF 361

Human   343 YQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFP 407
            :.||..:...:||:.|||:|||.::.:.|.|||.|:.|.|||:|:.|:.:........|..:.||
  Fly   362 FNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRIFFP 426

Human   408 VMYLNESVHIDKETASRLKSMINTTLIITNIPYIIMALGVFFGL 451
            :::..:.|.|..:.|.:||.          :|.::::..:|.|:
  Fly   427 LVWFEQKVRITPDMADQLKV----------LPIVMLSGHIFAGI 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCARB2NP_005497.1 CD36 28..455 CDD:307331 126/434 (29%)
Important for interaction with GBA 155..191 11/39 (28%)
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 126/434 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45589
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11923
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X155
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.