DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SCARB2 and santa-maria

Sequence 1:NP_005497.1 Gene:SCARB2 HGNCID:1665 Length:478 Species:Homo sapiens
Sequence 2:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster

Alignment Length:434 Identity:126/435 (29%)
Similarity:223/435 (51%) Gaps:31/435 (7%)


Human    34 DQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGET-PRVEEVGPYTYRELRNK 97
            |..:.|::.|...|..:::|:.||:.:....|.:|.||||:.....| |.:|:||||.:.|..:|
  Fly    42 DWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDFGNLSTKPILEQVGPYRFIERPDK 106

Human    98 ANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVL----TVIEWSQVHFLREIIEA 158
            .:|.:.....:::......:.|:...|.|... |.|.|||...|    |...|..|.  |.:::.
  Fly   107 VDIHWHPENASVTYRRRSLFYFDAAGSNGSLD-DEITTLNAVALSAAATAKYWPPVK--RSLVDV 168

Human   159 MLKAYQQKLFVTHTVDELLW-GYKDEILSL---IHVFRPDIS-PY--FGLFYEKNGTND--GDYV 214
            .||.|..::.|..::||||: ||.|.::.:   :.:|..::. |:  ||.||.:||:.|  |.:.
  Fly   169 GLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEVKVPFDKFGWFYTRNGSADLTGVFN 233

Human   215 FLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITK-DEVLYVFPSDFCRSVY 278
            ..||.|......::..||.:.:..:: ...|.|.||:.|: |.|...| .:.:.:|..|.||::.
  Fly   234 VFTGADQLAKLGQMHSWNYQENTGFF-DSYCGMTNGSAGE-FQPQHLKPGDSVGLFTPDMCRTIP 296

Human   279 ITFSDYESVQGLPAFRYK-VPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHF 342
            :.:.:...::||..:::. .|..:...|......|...|.|:.|||:|:|.|:.|:|:.||:|||
  Fly   297 LDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFCGGQCVPSGVMNISSCRFGSPVFMSYPHF 361

Human   343 YQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFP 407
            :.||..:...:||:.|||:|||.::.:.|.|||.|:.|.|||:|:.|:.:........|..:.||
  Fly   362 FNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRIFFP 426

Human   408 VMYLNESVHIDKETASRLKSMINTTLIITNIPYIIMALGVFFGL 451
            :::..:.|.|..:.|.:||.          :|.::::..:|.|:
  Fly   427 LVWFEQKVRITPDMADQLKV----------LPIVMLSGHIFAGI 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCARB2NP_005497.1 CD36 28..455 CDD:307331 126/435 (29%)
Important for interaction with GBA 155..191 11/40 (28%)
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 126/435 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.