DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTO1 and GstE1

Sequence 1:NP_004823.1 Gene:GSTO1 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster

Alignment Length:208 Identity:50/209 (24%)
Similarity:90/209 (43%) Gaps:37/209 (18%)


Human    24 IRIYSMRFCPFAERTRLVLKAKGIRHEVININL---KNKPEWFFKKNPFGLVPVLENSQGQLIYE 85
            |.:|.....|.....:|.||...:.:|...:||   ::..|.:.||||...||:|::: |..|::
  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDN-GTFIWD 69

Human    86 SAITCEYLDEAY-PGKKLLPDDPYEKAC--QKMILE---LFSKVPSLVGSFIRS------QNKED 138
            |.....||.:.| ...:|.|.|..::|.  |::..:   :::.:.::...|..:      |.|.|
  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLD 134

Human   139 --YAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVD----HTP 197
              :.|||        .||..|.|  :.:..|:|:::.|....|....:.|     .||    ..|
  Fly   135 AVHQGLK--------LLETFLGN--SPYLAGDSLTLADLSTGPTVSAVPA-----AVDIDPATYP 184

Human   198 KLKLWMAAMKEDP 210
            |:..|:..:.:.|
  Fly   185 KVTAWLDRLNKLP 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 22/73 (30%)
Glutathione binding. {ECO:0000269|PubMed:10783391, ECO:0000269|PubMed:21106529} 85..86 0/1 (0%)
GST_C_Omega 108..229 CDD:198293 24/121 (20%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 22/74 (30%)
GstA 8..197 CDD:223698 48/205 (23%)
GST_C_Delta_Epsilon 94..210 CDD:198287 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91315777
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.71939 Normalized mean entropy S4834
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.880

Return to query results.
Submit another query.