DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TJP2 and pyd

Sequence 1:NP_001163887.1 Gene:TJP2 HGNCID:11828 Length:1221 Species:Homo sapiens
Sequence 2:NP_001246998.1 Gene:pyd FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster

Alignment Length:1316 Identity:396/1317 (30%)
Similarity:581/1317 (44%) Gaps:344/1317 (26%)


Human    60 WEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPM 124
            ||.:||.:.:....|||||||||||||||.||:.||.:||||.||||:..||.|||::.|||..:
  Fly   246 WEYHTVAVTRVPGYGFGIAVSGGRDNPHFANGDPSIAVSDVLKGGPAEDRLQVNDRIISVNGVSL 310

Human   125 EDVLHSFAVQQLRKSGKVAAIVVKRPRKVQVAALQASPPLDQDDRAFEVMDEFDGRSFRSGYSER 189
            |:|.::.|||.||.||....:||||           ..||:..:.|..|..:..    .|..|..
  Fly   311 ENVEYATAVQVLRDSGNTVQLVVKR-----------RVPLNPINAAGAVQHQHS----HSLSSVG 360

Human   190 SRLNSHGGRSRSWEDSPERGRPHERARSRERDLSRDRSRGRSLERGLDQDHARTRDRSRGRSLER 254
            ...|..||                .|.:....||:..|...||          .::.|.|:    
  Fly   361 LMANGSGG----------------VAPTPITSLSQPNSLNSSL----------VQNASSGQ---- 395

Human   255 GLDHDFGPSRDRDRDRSRGRSIDQDYERAYHRAYDPDYERAYSPEYRRGARHDARSRGPRSRSRE 319
                                                                             
  Fly   396 ----------------------------------------------------------------- 395

Human   320 HPHSRSPSPEPRGRPGPIGVLLMKSRANEEYGLRLGSQIFVKEMT---RTGLATKDGNLHEGDII 381
                            ||.|.|.|....::||:.||.::||||::   |..|.....:|.|||||
  Fly   396 ----------------PIKVTLTKGGKKDDYGVVLGCRLFVKEISSKAREQLNANGYSLQEGDII 444

Human   382 LKINGT-VTENMSLTDARKLIEKSRGKLQLVVLRD-SQQTLINIPSLNDSDS------------- 431
            .:|:.| ..:.|||.:|:|:|:..:.:|.|||||| :.||.::..:||:|.|             
  Fly   445 TRIHNTNCGDTMSLKEAKKIIDGCKERLNLVVLRDITNQTAVSQLNLNNSASHQASGNIYATHQP 509

Human   432 EIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSR------------EDTPSRLSRMG 484
            ::...|...:|       ....|.......||:.|..:|.:|            .|..|.|:..|
  Fly   510 QVSGCSSSNNN-------LEDPYLPGGASYSSQNLYVQPPTRTSNGPNINGNGLNDEKSNLTPRG 567

Human   485 ATPTPFK---STGDIAGTVVPETNKEPRYQEDPPAPQPK-----AAPRTFL---RPSPEDEAIYG 538
            .:..|..   |...:...|.|...:.....|.|..|.|:     ||...|.   |...|:.....
  Fly   568 RSRGPIMDGVSLQQLDRPVTPTRGRSAAIDEPPRPPPPRGSSGGAAQEDFYSSRRQLYEERQSAE 632

Human   539 PNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNTQDFRGLVREDAV 603
            |  :.:.|:|..|||:||.|||:.||||..:|.|:.|..:||..||:|||||..|..|:.||:||
  Fly   633 P--RFISFQKEGSVGIRLTGGNEAGIFVTAVQPGSPASLQGLMPGDKILKVNDMDMNGVTREEAV 695

Human   604 LYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETPQSLAFTRGEVFRVVDTL 668
            |:||.:.  :.:.::.|...:.|.:::...|||||.|::||.|:..:...:||..|:||||:|||
  Fly   696 LFLLSLQ--DRIDLIVQYCKEEYDEVVTNQRGDSFHIKTHFHCDNPSKGEMAFKAGDVFRVIDTL 758

Human   669 YDGKLGNWLAVRIG---NELEKGLIPNKSRAEQMASVQ-NAQRD--NAGD-RADFWRMRGQRSGV 726
            ::|.:|:|..::||   .|:::|:||||||||::|:.| ||.:.  ||.: |.:|:|.|  ||..
  Fly   759 HNGVVGSWQVLKIGRGHQEMQRGVIPNKSRAEELATAQFNATKKEMNANESRGNFFRRR--RSTH 821

Human   727 KKNLRKSREDLTAVV---SVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLANELPDWFQT 788
            :::...|||:...||   |:| ||||||||:||..||.||||||||::|:|.|:||.:.||.|.|
  Fly   822 RRSKSLSRENWDDVVFSDSIS-KFPAYERVVLRHPGFVRPVVLFGPVSDLARERLAKDFPDKFST 885

Human   789 -AKTEPKDAGSEKSTGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGV 852
             .:.:.|.|.:.....:|||:.:|.::::.||||||:||.|||.|||.|::|:|||...||:..:
  Fly   886 PLQDDDKSAATSGKCRIVRLSNIRDVMDRGKHALLDITPNAVDRLNYAQFYPVVIFLKTDSKHVI 950

Human   853 KTMRQRLNPTSNKSSRKLFDQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQHQQGEAVWVS 917
            |.:|..|...::|||:||.:|..||::..:|:|:..|.| |..:||:..|:|:|..||..|||:|
  Fly   951 KQLRHGLPKAAHKSSKKLLEQCQKLERVWSHIFSTQIAL-SDEESWYRKLRDSIDLQQSGAVWMS 1014

Human   918 EGK-MEGMDDDPEDRMSYLTAMGADYLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSIT 981
            |.| :|.:.||      :|..|....||..|...||.|.:.|...:.:...|.:     ||.:  
  Fly  1015 ESKPVESLSDD------FLFPMTTSRLSYASSPESDLELSPGPSASLSLGNLPQ-----LVKA-- 1066

Human   982 RSSEPVQHEESIRKPSPEPRAQMRRAASSDQL-RDNS------PPPAFKP-EPPKAKTQNKEESY 1038
             ||:|     ||             |.:.|.| ||..      |||...| :.......|:.::.
  Fly  1067 -SSDP-----SI-------------ATNQDNLDRDRDIIGEGLPPPYTVPYDHAVPANPNRRQTM 1112

Human  1039 DFSKSYEYKSN-------------PSAVAGNETPGASTKGYPPPV--AAKP-------------- 1074
            |.||...|.:|             .:||......|.:....||.:  .:||              
  Fly  1113 DSSKYSIYGTNVPPQQQQPGVGGDTAAVRPQSLYGINAPDLPPRIDRQSKPGDIPLNTSGSSSRN 1177

Human  1075 -TFGRSILKPSTPIPPQE---GEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQ----EL 1131
             |.|||         .||   |:.|.:...:.:...::.|......|.:|.:.:.|:..    |.
  Fly  1178 GTLGRS---------AQERLFGKAVVQDDVQAEYITRNALVGSGAAETLDRQQQQQQQTHASLER 1233

Human  1132 QEAQNARI---------------------------EIAQKH---------PDIYAVPIKTHKPDP 1160
            |...||::                           ::|.::         .|:.:||....:|.|
  Fly  1234 QARLNAQLKANGVGAGGGGASTYDSVSSYDSYNNTQMAMQNLGRLGPNAPDDLKSVPNANGRPLP 1298

Human  1161 GTPQ-HTSSRPPEP------------QKAPSRP-YQDTRGSYGSDAE------------EEEYRQ 1199
            .|.| |...|.|..            |.:|.|| |.|...|...|..            |...|:
  Fly  1299 PTGQSHEYGRTPHDHRSFGGPNDLNRQSSPGRPHYHDMNASRNIDPRNGTPQRPSNLGLESSPRK 1363

Human  1200 QLSEHSKRGYYGQSAR 1215
            .|.|  .:..||:.:|
  Fly  1364 PLVE--TKTDYGKYSR 1377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TJP2NP_001163887.1 PDZ_signaling 63..148 CDD:238492 48/85 (56%)
PDZ 330..413 CDD:278991 33/87 (38%)
DegQ <333..423 CDD:223343 38/95 (40%)
PDZ_signaling 541..618 CDD:238492 35/77 (45%)
SH3_ZO-2 635..697 CDD:212960 32/65 (49%)
GuKc 731..910 CDD:214504 85/183 (46%)
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492 48/85 (56%)
PDZ_signaling 396..477 CDD:238492 33/81 (41%)
PDZ_signaling 633..710 CDD:238492 36/81 (44%)
SH3_ZO 729..790 CDD:212793 28/61 (46%)
GuKc 831..1007 CDD:214504 82/178 (46%)
ZU5 2263..2351 CDD:279170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115499071
eggNOG 1 0.900 E1_KOG3580
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 605 1.000 Inparanoid score I924
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1175136at2759
OrthoFinder 1 1.000 FOG0001893
OrthoInspector 1 1.000 T608289
orthoMCL 1 0.900 OOG5_129845
Panther 1 1.100 O PTHR13865
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3326
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.