DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SELENOF and CG7484

Sequence 1:NP_004252.2 Gene:SELENOF HGNCID:17705 Length:165 Species:Homo sapiens
Sequence 2:NP_649000.1 Gene:CG7484 FlyBaseID:FBgn0036745 Length:178 Species:Drosophila melanogaster

Alignment Length:146 Identity:72/147 (49%)
Similarity:93/147 (63%) Gaps:4/147 (3%)


Human    20 LLLATVLQAVSAFGAEFSSEACRELGF-SSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETK 83
            ||||...|.:.   ||.::..||.||| .:.|:||||:.|..|.|..:.|.|:.||..:.|...:
  Fly     8 LLLALSCQQIQ---AELTAADCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQPAAQ 69

Human    84 KLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILK 148
            :.||.||||||..|...:||:|||::|.:|..|..||||||||.|||:||||.:|.:.|.|||.|
  Fly    70 RTYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSITK 134

Human   149 WNTDSVEEFLSEKLER 164
            ||||:||||....|.:
  Fly   135 WNTDTVEEFFETHLAK 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SELENOFNP_004252.2 Sep15_SelM 88..163 CDD:312367 45/75 (60%)
CG7484NP_649000.1 Sep15_SelM 74..148 CDD:285958 44/74 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C271801461
eggNOG 1 0.900 E1_KOG3384
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H3145
Inparanoid 1 1.050 138 1.000 Inparanoid score I4457
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1405992at2759
OrthoFinder 1 1.000 FOG0006495
OrthoInspector 1 1.000 T1074964
orthoMCL 1 0.900 OOG5_132726
Panther 1 1.100 LDO PTHR13077
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.