DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC22A8 and CG4630

Sequence 1:NP_001171661.1 Gene:SLC22A8 HGNCID:10972 Length:542 Species:Homo sapiens
Sequence 2:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster

Alignment Length:575 Identity:163/576 (28%)
Similarity:262/576 (45%) Gaps:80/576 (14%)


Human     1 MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPH-----NASTGP- 59
            :.|.:||..:|..|.||..:..::.||:|..|.::|..:|||.:|.:.|..|.     :|..|. 
  Fly    13 LDFDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGAN 77

Human    60 WVLPMGPNG-------KPERCLRFV----HPPNASLP---------------NDTQRAMEPCLDG 98
            ||....|..       .|..|.|||    |..::|.|               .:|:|..:     
  Fly    78 WVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTTETERCNQ----- 137

Human    99 WVYNSTKDSIVTEWDLVCNSNKLK-EMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAA 162
            :||.|::.:||.:|.|.|..|..| ....:|..||:::|..:.|.|:||:||:.|.....:.:|.
  Fly   138 FVYGSSERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFLFCIVFMAL 202

Human   163 SGSGAAFSPTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPG 227
            :|...|.|..:..::.|..|...|.||:.....|:.||.|..|.|.:.|..|.|.|..|:.:| |
  Fly   203 TGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAVGEALL-G 266

Human   228 LAYAIPQWRWLQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERL 292
            |:..:|.||.|||.:|:|..:.....|..|||:|||:...:..:|..|:||.|..|.:.     :
  Fly   267 LSVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAAKVNRRD-----I 326

Human   293 SLEELKLNLQKEISLA-----------------KAKYTASDLFRIPMLRRMTFCLSLAWFATGFA 340
            |:|.:....|:|:...                 |......::.|..:|......|.|.|......
  Fly   327 SVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAILLLIWAVNAIV 391

Human   341 YYSLAMGVEEFGVNLYILQIIFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPL 405
            ||.|::.......|.|:...:...|::|...:..|.|...||....:.:|||.....:|..||.|
  Fly   392 YYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSITCVASGFVTL 456

Human   406 ------DLQT-------------VRTVLAVFGKGCLSSSFSCLFLYTSELYPTVIRQTGMGVSNL 451
                  ..||             :...|.:.||..::|||:.::.:|:|:.|||||..|:||.:.
  Fly   457 AQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRSGGVGVMST 521

Human   452 WTRVGSMVSPLVKITGEVQPFIPNIIYGITALLGGSAALFLPETLNQPLPETIED 506
            :.|.|:|::|.|.:.......:|.:::|..:|:.|..:|.||||.|:.||:|:|:
  Fly   522 FARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTVEE 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A8NP_001171661.1 2A0119 11..503 CDD:273328 158/561 (28%)
MFS 96..493 CDD:119392 122/434 (28%)
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 158/561 (28%)
MFS 158..533 CDD:119392 107/381 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.