DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COG7 and cog7

DIOPT Version :8

Sequence 1:NP_705831.1 Gene:COG7 / 91949 HGNCID:18622 Length:770 Species:Homo sapiens
Sequence 2:NP_001070861.1 Gene:cog7 / 768247 ZFINID:ZDB-GENE-061013-463 Length:767 Species:Danio rerio

Alignment Length:770 Identity:543/771 (70%)
Similarity:652/771 (85%) Gaps:3/771 (0%)


Human     1 MDFSKFLADDFDVKEWINAAFRAGSKEAASGKADGHAATLVMKLQLFIQEVNHAVEETSHQALQN 65
            ||||||||||||||:|:|.||:...|: |.||||.||:||||||||||||||:::||:|:|||||
Zfish     1 MDFSKFLADDFDVKDWVNGAFKVAQKD-APGKADAHASTLVMKLQLFIQEVNNSIEESSNQALQN 64

Human    66 MPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADK 130
            ||:||||:|||||||||||:||||||||||||||||.|||||||||||||||||||||:||||||
Zfish    65 MPRVLRDIEALKQEASFLKDQMILVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLAAEALQEADK 129

Human   131 WSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAA 195
            ||||||||||||||||:||||:|||.||.||.|||||||||||||.|||||||||||.|.|||:.
Zfish   130 WSTLSADIEETFKTQDVAVISSKLTAMQGSLAMLVDTPDYSEKCVQLEALKNRLEALTSTQIVST 194

Human   196 FTSQAVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQLTGLYDALLGA 260
            |.|.|.||:|:||:||||:|||||||||||||||.|||..|:.:||||..|.:||:..||.||..
Zfish   195 FNSLATDQAKLFVRVFTEMDRMPQLLAYYYKCHKAQLLTVWESICQSDAPLKQQLSEFYDTLLST 259

Human   261 WHTQIQWATQVFQKPHEVVMVLLIQTLGALMPSLPSCLSNGVERAGPEQELTRLLEFYDATAHFA 325
            ||||:||::|||:.|.||:.||:||||||::||:|.|::..::|...:..|..|||.:..:|:|:
Zfish   260 WHTQLQWSSQVFRNPCEVLTVLMIQTLGAMVPSIPDCIAETLKRCSGDCRLDVLLELHQTSANFS 324

Human   326 KGLEMALLPHLHEHNLVKVTELVDAVYDPYKPYQLKYGDMEESNLLIQMSAVPLEHGEVIDCVQE 390
            :.||.|:.|.|.|.||:||.|||..||.|||.||::||.:||:|||||:||||||.|||:|||.|
Zfish   325 RSLEAAMQPQLGECNLLKVAELVSCVYSPYKTYQIQYGGLEETNLLIQLSAVPLERGEVLDCVLE 389

Human   391 LSHSVNKLFGLASAAVDRCVRFTNGLGTCGLLSALKSLFAKYVSDFTSTLQSIRKKCKLDHIPPN 455
            |:|||.|:||||:|||||||:||:||..|||:.||::||.||||||:.||||||||.||:..|.:
Zfish   390 LTHSVQKVFGLAAAAVDRCVKFTDGLAVCGLIKALRALFNKYVSDFSVTLQSIRKKYKLEDTPTS 454

Human   456 SLFQEDWTAFQNSIRIIATCGELLRHCGDFEQQLANRILSTAGKYLSDSCSPRSLAGFQESILTD 520
            .:|.|||||||||:|:|||||||||.||.|||||:|:||..||::|.:..:||||.|.||.:.  
Zfish   455 EVFTEDWTAFQNSVRVIATCGELLRQCGAFEQQLSNKILGRAGRFLWEGFNPRSLTGLQEGVA-- 517

Human   521 KKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDS 585
            ::.|.|||||||||||:.|.|||.:|:|.|::|||||:.|.:|||..|||||||||||:||||||
Zfish   518 ERRSQKNPWQEYNYLQQSNTAEYNNLLETLHSLKEKGTGNSSLLAETRAALTRLNQQANQLAFDS 582

Human   586 VFLRIKQQLLLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDS 650
            |||:|||||.|::|.::..:|.:||||||:||||||:|.|||:|||||||||||:|||||||||.
Zfish   583 VFLQIKQQLFLLNKPEARGSASLGETLTDDLPAFSLSPQEYITNIGQYIMSLPLHLEPFVTQEDP 647

Human   651 ALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDI 715
            |||||||.||||:||||||::|||:|.||.|||||||||||||||.|||:||||.|..|||||||
Zfish   648 ALELALHTGKLPYPPEQGDDVPELENTADYWLGSIARATMQTYCDVILQLPELSAHHTKQLATDI 712

Human   716 DYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVNY 770
            |||.|||||||||.|||||:|||||:.:|::|||.:|.|||||:.|:|.:|.:.|
Zfish   713 DYLSNVMDALGLQTSRTLQNIVTLLRVKPDEYRQTAKTLPRRLSATIANIRGLEY 767

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COG7NP_705831.1 COG7 2..767 CDD:287200 541/765 (71%)
cog7NP_001070861.1 COG7 2..764 CDD:287200 541/765 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311982284
eggNOG 1 0.900 E1_KOG4182
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H33431
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D198192at33208
OrthoFinder 1 1.000 FOG0007671
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131606
Panther 1 1.100 LDO PTHR21443
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 1 1.500
1111.220

Return to query results.
Submit another query.