DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COG7 and cog7

DIOPT Version :8

Sequence 1:NP_705831.1 Gene:COG7 / 91949 HGNCID:18622 Length:770 Species:Homo sapiens
Sequence 2:NP_001015714.1 Gene:cog7 / 548431 XenbaseID:XB-GENE-970837 Length:768 Species:Xenopus tropicalis

Alignment Length:770 Identity:583/771 (76%)
Similarity:682/771 (88%) Gaps:2/771 (0%)


Human     1 MDFSKFLADDFDVKEWINAAFRAGSKEAASGKADGHAATLVMKLQLFIQEVNHAVEETSHQALQN 65
            ||||:||||||:||:|:||||::..|:|.: |.|.||:||||||||||||||::|||.|||||||
 Frog     1 MDFSRFLADDFEVKDWVNAAFKSVQKDAPA-KVDAHASTLVMKLQLFIQEVNNSVEEISHQALQN 64

Human    66 MPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADK 130
            ||:|||||||::||||||||||||||||||||||||:||||||||:|:|||||||||:|||||||
 Frog    65 MPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEMDKVKSRMQLAADSLQEADK 129

Human   131 WSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAA 195
            |||||||||||||||:|.|||.|||.||.||.|||||||||||||:||||||||||:.|||||||
 Frog   130 WSTLSADIEETFKTQNITVISEKLTSMQVSLTMLVDTPDYSEKCVYLEALKNRLEAMCSPQIVAA 194

Human   196 FTSQAVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQLTGLYDALLGA 260
            |.||:|||:|:|||||:||||||||||||||||||||:..||||||||:.||||||..||.||.|
 Frog   195 FNSQSVDQAKMFVKVFSEIDRMPQLLAYYYKCHKVQLVTVWQELCQSDMPLDRQLTEFYDTLLSA 259

Human   261 WHTQIQWATQVFQKPHEVVMVLLIQTLGALMPSLPSCLSNGVERAGPEQELTRLLEFYDATAHFA 325
            ||||:||.:|||:||.|||.||:||||.|::||:|.|||..:|||.||.:|:.|||.|:||.|||
 Frog   260 WHTQLQWVSQVFKKPQEVVTVLMIQTLAAMVPSIPVCLSTAMERASPEDKLSTLLELYNATGHFA 324

Human   326 KGLEMALLPHLHEHNLVKVTELVDAVYDPYKPYQLKYGDMEESNLLIQMSAVPLEHGEVIDCVQE 390
            |.:|.|:||::.|:||||:.||||||:.|||||||:|||:||||||||:||:|||.|||:|||||
 Frog   325 KSMETAILPNMGEYNLVKLIELVDAVFGPYKPYQLQYGDLEESNLLIQISAMPLERGEVLDCVQE 389

Human   391 LSHSVNKLFGLASAAVDRCVRFTNGLGTCGLLSALKSLFAKYVSDFTSTLQSIRKKCKLDHIPPN 455
            |||||::||.|||.|:|||::||:|||.||||.||:|||.|||:|||.||||||||||||:||.:
 Frog   390 LSHSVSRLFSLASGAMDRCIKFTDGLGLCGLLQALQSLFKKYVTDFTLTLQSIRKKCKLDNIPAD 454

Human   456 SLFQEDWTAFQNSIRIIATCGELLRHCGDFEQQLANRILSTAGKYLSDSCSPRSLAGFQESILTD 520
            |||.|||:|||||:|||..||||||.|||||||||:|.||.|||:|||:.|||||.|.||:..:|
 Frog   455 SLFLEDWSAFQNSVRIIGACGELLRQCGDFEQQLASRFLSIAGKHLSDTYSPRSLTGIQETSYSD 519

Human   521 KKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDS 585
            :| |::|||.:||||||.:||:||:|||.||.|||||:.:.:||||.|:|.||.||.||||||||
 Frog   520 RK-SSRNPWHDYNYLQKGDPAQYANLMETLYMLKEKGAVSTSLLAASRSAFTRQNQVAHQLAFDS 583

Human   586 VFLRIKQQLLLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDS 650
            |||.|||||||:.||:||:..|.||.||::||.|||||||||||||||:|||||:||||||.|||
 Frog   584 VFLHIKQQLLLVPKMESWSCEGSGEMLTEDLPTFSLTPLEYISNIGQYLMSLPLHLEPFVTPEDS 648

Human   651 ALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDI 715
            .|||||||||||||||||:|.||||||||.||||:||||||||||.||||..|:||:.|||||||
 Frog   649 TLELALHAGKLPFPPEQGEETPELDNMADYWLGSLARATMQTYCDVILQISLLTPHTTKQLATDI 713

Human   716 DYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVNY 770
            ||||||||||||||:|||||||||||.:||:||.|:|.|||:|::::|.|||:.|
 Frog   714 DYLINVMDALGLQPTRTLQHIVTLLKAKPEEYRPVAKSLPRKLSSSIAAMRSLEY 768

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COG7NP_705831.1 COG7 2..767 CDD:287200 580/765 (76%)
cog7NP_001015714.1 COG7 2..765 CDD:287200 580/765 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311859222
eggNOG 1 0.900 E1_KOG4182
Hieranoid 1 1.000
Homologene 1 1.000 H33431
Inparanoid 1 1.050 1183 1.000 Inparanoid score I1999
OMA 1 1.010
OrthoDB 1 1.010 D198192at33208
OrthoFinder 1 1.000 FOG0007671
OrthoInspector 1 1.000 T1889622
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4519
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.