DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COG7 and Cog7

DIOPT Version :8

Sequence 1:NP_705831.1 Gene:COG7 / 91949 HGNCID:18622 Length:770 Species:Homo sapiens
Sequence 2:NP_001029061.1 Gene:Cog7 / 293456 RGDID:1566058 Length:770 Species:Rattus norvegicus

Alignment Length:770 Identity:704/771 (91%)
Similarity:733/771 (95%) Gaps:0/771 (0%)


Human     1 MDFSKFLADDFDVKEWINAAFRAGSKEAASGKADGHAATLVMKLQLFIQEVNHAVEETSHQALQN 65
            ||||||||||||||:|||||||||.|:.|:|||||||||||||||||||||||||||||.|||||
  Rat     1 MDFSKFLADDFDVKDWINAAFRAGPKDGAAGKADGHAATLVMKLQLFIQEVNHAVEETSLQALQN 65

Human    66 MPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADK 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    66 MPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADK 130

Human   131 WSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAA 195
            ||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||
  Rat   131 WSTLSADIEETFKTQDIAVISAKLTGMQSSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAA 195

Human   196 FTSQAVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQLTGLYDALLGA 260
            ||||:||||||||||||||||||||||||||||||||||.||||||.||.|||||||||.|||||
  Rat   196 FTSQSVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLATWQELCQRDLPLDRQLTGLYHALLGA 260

Human   261 WHTQIQWATQVFQKPHEVVMVLLIQTLGALMPSLPSCLSNGVERAGPEQELTRLLEFYDATAHFA 325
            ||||.|||||||:.|:|||.||||||||||:||||.|||..|||||||.||||||||||.|||||
  Rat   261 WHTQTQWATQVFKNPYEVVTVLLIQTLGALVPSLPMCLSEAVERAGPELELTRLLEFYDTTAHFA 325

Human   326 KGLEMALLPHLHEHNLVKVTELVDAVYDPYKPYQLKYGDMEESNLLIQMSAVPLEHGEVIDCVQE 390
            |||||||||||.:||||||.|||||||.|||||||||||:||||||||:||||||||||||||||
  Rat   326 KGLEMALLPHLQDHNLVKVVELVDAVYGPYKPYQLKYGDLEESNLLIQISAVPLEHGEVIDCVQE 390

Human   391 LSHSVNKLFGLASAAVDRCVRFTNGLGTCGLLSALKSLFAKYVSDFTSTLQSIRKKCKLDHIPPN 455
            ||.||:|||||||||||||.:|||||||||||:||||||.||||.||:.|||||||||||.||||
  Rat   391 LSQSVHKLFGLASAAVDRCAKFTNGLGTCGLLTALKSLFTKYVSHFTNALQSIRKKCKLDDIPPN 455

Human   456 SLFQEDWTAFQNSIRIIATCGELLRHCGDFEQQLANRILSTAGKYLSDSCSPRSLAGFQESILTD 520
            |||||||||||||:|||||||||||.|||||||||||||||||||||||.|||||||||:|||||
  Rat   456 SLFQEDWTAFQNSVRIIATCGELLRQCGDFEQQLANRILSTAGKYLSDSYSPRSLAGFQDSILTD 520

Human   521 KKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDS 585
            ||:.||||||||||||||||||||:|||||||||||||||||||:..|.||||||||||||||||
  Rat   521 KKSPAKNPWQEYNYLQKDNPAEYANLMEILYTLKEKGSSNHNLLSVSRTALTRLNQQAHQLAFDS 585

Human   586 VFLRIKQQLLLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDS 650
            |||||||||||:|:|||||||||||||||:|||||||||||||||||||||||||||||||||||
  Rat   586 VFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDS 650

Human   651 ALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDI 715
            ||||||||||||||||||:||||||||||||||||||||||||||.|||||.::|||.|||||||
  Rat   651 ALELALHAGKLPFPPEQGEELPELDNMADNWLGSIARATMQTYCDGILQIPAVTPHSTKQLATDI 715

Human   716 DYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVNY 770
            |||||||||||||||||||:|.||||.:||:|||||||||||||.||||||.|||
  Rat   716 DYLINVMDALGLQPSRTLQNIATLLKAKPEEYRQVSKGLPRRLAATVATMRGVNY 770

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COG7NP_705831.1 COG7 2..767 CDD:287200 700/765 (92%)
Cog7NP_001029061.1 COG7 2..767 CDD:287200 700/765 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311636524
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H33431
Inparanoid 1 1.050 1399 1.000 Inparanoid score I3008
OMA 1 1.010
OrthoDB 1 1.010 D15777at314146
OrthoFinder 1 1.000 FOG0007671
OrthoInspector 1 1.000 T2472018
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21443
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1111.510

Return to query results.
Submit another query.