DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COG7 and Cog7

DIOPT Version :8

Sequence 1:NP_705831.1 Gene:COG7 / 91949 HGNCID:18622 Length:770 Species:Homo sapiens
Sequence 2:XP_006507762.2 Gene:Cog7 / 233824 MGIID:2685013 Length:782 Species:Mus musculus

Alignment Length:782 Identity:712/783 (91%)
Similarity:739/783 (94%) Gaps:12/783 (2%)


Human     1 MDFSKFLADDFDVKEWINAAFRAGSKEAASGKADGHAATLVMKLQLFIQEVNHAVEETSHQALQN 65
            ||||||||||||||:|||||||||.|:.|:|||||||||||||||||||||||||||||.|||||
Mouse     1 MDFSKFLADDFDVKDWINAAFRAGPKDGAAGKADGHAATLVMKLQLFIQEVNHAVEETSLQALQN 65

Human    66 MPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADK 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    66 MPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADK 130

Human   131 WSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAA 195
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:
Mouse   131 WSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAS 195

Human   196 FTSQAVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQLTGLYDALLGA 260
            ||||:||||||||||||||||||||||||||||||||||.|||||||||.|||||||||||||||
Mouse   196 FTSQSVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLATWQELCQSDLPLDRQLTGLYDALLGA 260

Human   261 WHTQIQWATQVFQKPHEVVMVLLIQTLGALMPSLPSCLSNGVERAGPEQELTRLLEFYDATAHFA 325
            ||||.|||||||:.|||||.||||||||||:||||.|||.||||||||.||||||||||.|||||
Mouse   261 WHTQTQWATQVFKNPHEVVTVLLIQTLGALVPSLPMCLSAGVERAGPELELTRLLEFYDTTAHFA 325

Human   326 KGLEMALLPHLHEHNLVKVTELVDAVYDPYKPYQLKYGDMEESNLLIQMSAVPLEHGEVIDCVQE 390
            |||||||||||.:||||||.|||||||.||||:|||||||||:|||||:||||||||||||||||
Mouse   326 KGLEMALLPHLQDHNLVKVVELVDAVYGPYKPFQLKYGDMEENNLLIQISAVPLEHGEVIDCVQE 390

Human   391 LSHSVNKLFGLASAAVDRCVRFTNGLGTCGLLSALKSLFAKYVSDFTSTLQSIRKKCKLDHIPPN 455
            |||||:|||||||||||||.:|||||||||||:|||||||||||.||:.|||||||||||.||||
Mouse   391 LSHSVHKLFGLASAAVDRCAKFTNGLGTCGLLTALKSLFAKYVSHFTNALQSIRKKCKLDDIPPN 455

Human   456 SLFQEDWTAFQNSIRIIATCGELLRHCGDFEQQLANRILSTAGKYLSDSCSPRSLAGFQESILTD 520
            |||||||||||||:|||||||||||.|||||||||||||||||||||||.|||||||||:|||||
Mouse   456 SLFQEDWTAFQNSVRIIATCGELLRQCGDFEQQLANRILSTAGKYLSDSYSPRSLAGFQDSILTD 520

Human   521 KKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDS 585
            ||:.||||||||||||||||||||||||||||||||||||||||:|.|.||||||||||||||||
Mouse   521 KKSPAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLSASRTALTRLNQQAHQLAFDS 585

Human   586 VFLRIKQQLLLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDS 650
            |||||||||||:|:|||||||||||||||:|||||||||||||||||||||||||||||||||||
Mouse   586 VFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDS 650

Human   651 ALELALHAGKLPFPPEQ------------GDELPELDNMADNWLGSIARATMQTYCDAILQIPEL 703
            |||||||||||||||||            ||||||||||||||||||||||||||||.||||||:
Mouse   651 ALELALHAGKLPFPPEQGMCAPPALWELAGDELPELDNMADNWLGSIARATMQTYCDVILQIPEV 715

Human   704 SPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSV 768
            :|||.||||||||||||||||||||||||||:|..|||.:||:|||||||||||||.||||||.|
Mouse   716 TPHSTKQLATDIDYLINVMDALGLQPSRTLQNIAALLKAKPEEYRQVSKGLPRRLAATVATMRGV 780

Human   769 NY 770
            ||
Mouse   781 NY 782

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COG7NP_705831.1 COG7 2..767 CDD:287200 708/777 (91%)
Cog7XP_006507762.2 COG7 2..779 CDD:287200 708/777 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311637050
eggNOG 1 0.900 E1_KOG4182
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H33431
Inparanoid 1 1.050 1414 1.000 Inparanoid score I3258
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007671
OrthoInspector 1 1.000 T2455980
orthoMCL 1 0.900 OOG5_131606
Panther 1 1.100 LDO PTHR21443
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4519
TreeFam 1 0.960
1414.290

Return to query results.
Submit another query.