DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and CG4476

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_648293.1 Gene:CG4476 / 39056 FlyBaseID:FBgn0035969 Length:629 Species:Drosophila melanogaster

Alignment Length:628 Identity:219/629 (35%)
Similarity:343/629 (55%) Gaps:63/629 (10%)


Human   168 SVLPGSVATVATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIP 232
            ::|..|:..:|.:..|...:.|||.||.|.|:|::|.:..:||||||||||:.|.:|||||||||
  Fly    28 ALLKPSLLPMALESSELSPDRKARDNWGSSLEFLMSCIALSVGLGNVWRFPFTALENGGGAFLIP 92

Human   233 YLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFY 297
            ||::|.:.|.||:::|:.||||:|:|.|.|:...|.::|.|.|.|:...::|.||..::..||.|
  Fly    93 YLVVLFVVGKPIYYMEMLLGQFSSRGIVQVFDFAPLMRGVGYAQLLALGVLATYYASVMALTLRY 157

Human   298 LFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCV-ISDHPKIQIKNSTFCMTAYPNVTMVNFTS 361
            .|.||.|.|||..|...|.            |.|| .|....:|                    .
  Fly   158 FFDSFASELPWSFCREEWG------------DGCVSASGGQPLQ--------------------G 190

Human   362 QANKTFVSGSEEYFKYFVL----KISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVV 422
            |.::.|.|.::.|.:..||    .:..||.||.   ..|||.|.::|:.|...:.:|:|:|||..
  Fly   191 QLSRNFSSSTQLYLQRIVLNETDSLEEGIGYPS---GSLALMLGISWLTVTLIIIRGVKSSGKAA 252

Human   423 YFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLIT 487
            |..|.|||||:.|||:|.:|||||..|:.||:||:||||.:..||.:|.||:||||:..:|.:|.
  Fly   253 YVLALFPYVVMFILLVRALTLPGAYDGVMYFLTPQWEKLLEPQVWYNAVTQVFFSLAVCFGVIIM 317

Human   488 LSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVVYP 551
            .||||:|.:|.|||..|||..::.||:.:|.:||.::|.:|:|... :|.:|...|||:||:.||
  Fly   318 YSSYNRFGHNVYRDANIVTTLDTFTSLLSGVIIFGILGNLAHESGTKDIASVVKAGPGLAFISYP 382

Human   552 EALTRLPLSP-FWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFI 615
            :|:.:..:.| .::::||.||..||:.:....:..|:|.:.|:|   :.....:..:...:..|:
  Fly   383 DAIAKFKMFPQVFSLLFFAMLFMLGVGSNVGMVSCIMTVLKDQF---VNVKLWIIVVSLSVIGFL 444

Human   616 MGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVC 680
            :|...||.||.::..|:|.:..::..::.|||||:.:.::||.:|.|:|.|.|:..:.:.::::|
  Fly   445 VGLIYITPGGQHIITLMDFHGVTFVSLVSAIFELIAVGWIYGTKRLCQDAEYMLNIKTSNYYRIC 509

Human   681 WAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSV----IWIPIMFVIKMHLAP 741
            |:.|||.::..||.:|.....|::|....:|....|:||.:..|.:    .|..   ........
  Fly   510 WSIVTPLVMLVILVYSLLTMRPLSYNGQEFPLVYRVVGWCVSGCIIGQLFYWAG---YANFKQPK 571

Human   742 GRFIERLKLVCSPQPDWGP-----------FLAQHRGERYKNM 773
            |....|:.....|..||||           ||.....|..||:
  Fly   572 GSLKSRINNSIKPHSDWGPSDPKKLMDYQMFLRNKDEENSKNV 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 213/606 (35%)
CG4476NP_648293.1 SLC6sbd 52..526 CDD:271359 192/512 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107584597
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.