DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and SerT

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_001286839.1 Gene:SerT / 37895 FlyBaseID:FBgn0010414 Length:622 Species:Drosophila melanogaster

Alignment Length:677 Identity:267/678 (39%)
Similarity:392/678 (58%) Gaps:80/678 (12%)


Human   100 AQGAQASPPPGS---SGPGNALHCKIPFLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVL 161
            |...:::|.|.|   ..|.|            |.|:|...|..|                 |...
  Fly    14 ATTGRSNPAPWSDDKESPNN------------EDDSNEDDGDHT-----------------TPAK 49

Human   162 GTDGITSVLPGS--VATVATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQN 224
            .||.:...|..:  :..|:..|       :.|..|..|.:|:|:::|:||.|||||||||:.:||
  Fly    50 VTDPLAPKLANNERILVVSVTE-------RTRETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQN 107

Human   225 GGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAI-PALQGCGIAMLIISVLIAIYYN 288
            ||||||:||.:.|...|||:|::|::||||...|.:|:||.| |||:|.|.|:.:|.:.:.:|||
  Fly   108 GGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYN 172

Human   289 VIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPN 353
            .||.:.::||||||.|.|||.||:|||||..|.                               .
  Fly   173 TIIGWAVYYLFASFTSKLPWTSCDNPWNTENCM-------------------------------Q 206

Human   354 VTMVNFTSQANKTFVSGSEEYFKYFVLKI--SAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIK 416
            ||..|||..|    .|.::|:|:..||:.  ..|:::.|.::..||||:|..:|:||.||.||::
  Fly   207 VTSENFTELA----TSPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVR 267

Human   417 TSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAA 481
            ::||||:.||..|||||:|||:|||:||||..||.|::||:|.||.::.||.|||:||||||...
  Fly   268 SAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPG 332

Human   482 WGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIA 546
            :|.|:.|||||||:||||||.||.:..|..||..||||||||:|:||..:|.:|:.|..:|||:.
  Fly   333 FGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIFSVLGYMAYVQKTSIDKVGLEGPGLV 397

Human   547 FVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCI 611
            |:|||||:..:..|.||:|||||||:|||||:.|..:|.::|::.||:|:.:...:.:|.|....
  Fly   398 FIVYPEAIATMSGSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRRELFVLLLLA 462

Human   612 CFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIF 676
            ..|:...|.:|.||:.:...::.|....|::.:...|..|:.:.||:.||..|:|.|:|.:|.:|
  Fly   463 FIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDVEQMLGSKPGLF 527

Human   677 WKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLA- 740
            |::||.:::|..|..|..||...::.|....|.||:||..:||.:...||:.||:..:.|...| 
  Fly   528 WRICWTYISPVFLLTIFIFSIMGYKEMLGEEYYYPDWSYQVGWAVTCSSVLCIPMYIIYKFFFAS 592

Human   741 PGRFIERLKLVCSPQPDWGPFLAQHRG 767
            .|...:||:....|:.:.|..:...:|
  Fly   593 KGGCRQRLQESFQPEDNCGSVVPGQQG 619

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 250/582 (43%)
SerTNP_001286839.1 SLC6sbd_SERT-like 74..607 CDD:271388 248/568 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.