DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and List

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_611364.2 Gene:List / 37157 FlyBaseID:FBgn0034381 Length:564 Species:Drosophila melanogaster

Alignment Length:593 Identity:217/594 (37%)
Similarity:327/594 (55%) Gaps:55/594 (9%)


Human   179 TQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLP 243
            :::.|:..|..|. .|.:.|:|:.|.:..:|||||:|||||:|||||||.|:||||:.|.:.|.|
  Fly     7 SKKSEKPAEKPAE-QWGNGLEFLFSCISLSVGLGNIWRFPYIAFQNGGGTFVIPYLIALLVIGRP 70

Human   244 IFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPW 308
            :::||:|||||..:|.|..:...|.|:|..:..::.:.....||:.|:..||.:..|||.|.|||
  Fly    71 VYYLEISLGQFTGRGVVKAFDMAPLLKGVALGQVLATAASITYYSSIMALTLRFWLASFGSELPW 135

Human   309 GSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEE 373
            ..|...|.| :|.|.                                  |..:.:.|  :|.::.
  Fly   136 SRCWESWGT-DCHDG----------------------------------NAQNSSGK--MSPAQL 163

Human   374 YFKYFVL----KISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLV 434
            ||:..:|    .|..|:..|   .|.|..||.:||:::...|.:|||:|||..||...||||||:
  Fly   164 YFEREILHEVPNIDNGLSLP---NWQLVACLAIAWLVIGGVLIRGIKSSGKAAYFLGVFPYVVLL 225

Human   435 ILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCY 499
            |||:|.||||||..||.||..|:|.:|.:..||..|.||:||||:..:|.|||.:|||.|:.|.|
  Fly   226 ILLLRAVTLPGAIDGIIYFFKPQWRELLNPLVWYAAVTQVFFSLAICFGTLITYASYNNFNRNVY 290

Human   500 RDTLIVTCTNSATSIFAGFVIFSVIGFMANER-KVNIENVADQGPGIAFVVYPEALTRLPLSP-F 562
            .|.:|:|..:|.:||.||.:.|.::|.:|.|. ..:|.:|...|.|:||:.||||:.:....| .
  Fly   291 NDIVIITTMDSCSSIIAGCITFGILGNLARETGNPDIGSVVKGGAGLAFISYPEAIAKFEYVPQM 355

Human   563 WAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTL--GCCICFFIMGFPMITQGG 625
            :|::|||||..||:.:.......|:..|.|:|.  ||: .|::.|  |..:..|.:....:|.||
  Fly   356 FAVLFFLMLFVLGIGSTVGMGSCILRVIRDQFG--LRS-PPIWKLASGLTVLGFSVSIVYMTPGG 417

Human   626 IYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILT 690
            .::..|||.|..|:..:|:||.|||.::::||:.||||||:.|:|.:...:|::||.|:||.::|
  Fly   418 QFILNLVDFYGVSFTALILAIGELVAVAWIYGVNRFCEDIKFMMGIETGWYWRLCWRFITPGLMT 482

Human   691 FILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIP---IMFVIKMHLAPGRFIERLKLVC 752
            .:|.:.......:.|....||..:.|.|..:....:|.:|   |..:.|.....|.|.:|::..|
  Fly   483 AVLIYMLLDMSALEYKGVGYPTLAHVFGCFLATLGLIQLPGWAIYAIYKKRGHNGSFWQRIRAAC 547

Human   753 SPQPDWGP 760
            .|...|||
  Fly   548 KPSDTWGP 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 214/582 (37%)
ListNP_611364.2 SLC6sbd 19..489 CDD:271359 197/514 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107584669
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.