DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and DAT

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_001261026.1 Gene:DAT / 36849 FlyBaseID:FBgn0034136 Length:644 Species:Drosophila melanogaster

Alignment Length:601 Identity:275/602 (46%)
Similarity:388/602 (64%) Gaps:21/602 (3%)


Human   172 GSVATVATQEDEQGDENK---ARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPY 233
            |.::...|......|.|.   .|..||.|:||:||::|:||.|.||||||||.::|||||||:||
  Fly     5 GHISKSKTPTPHDNDNNSISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPY 69

Human   234 LMMLALAGLPIFFLEVSLGQFASQGPVSVW-KAIPALQGCGIAMLIISVLIAIYYNVIICYTLFY 297
            .:||.:.|:|:|::|::|||...:|.::.| :.:|..:|.|.|:::|:..:..||||||.::|.:
  Fly    70 GIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRF 134

Human   298 LFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCM---TAYPNVTMVNF 359
            .||||.:.|||.||||.||||.|:.     .:|...|..|.|...:..:.|   :...|.|.:|.
  Fly   135 FFASFTNSLPWTSCNNIWNTPNCRP-----FESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNG 194

Human   360 TSQANKT------FVSGSEEYFKYFVLKI--SAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIK 416
            :|.....      |.|.:.|||..::|::  |.||...|.|:|.:||||.:.::|.|.||.|||.
  Fly   195 SSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGIS 259

Human   417 TSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAA 481
            ||||||:|||.|||.||:||||||:||||:..||.|::||.:..:..|.||.|||||:||||...
  Fly   260 TSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPG 324

Human   482 WGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIA 546
            :|.|:..:||||:|||.|:|.|:.:..|||||..||||||||:|:||:...|.||:||.:|||:.
  Fly   325 FGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLV 389

Human   547 FVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCI 611
            |||||.|:..:|.|.|||:|||:||||||||:.|...|.|:|::|||||| ::.::.:|..|...
  Fly   390 FVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPK-IKRNRELFVAGLFS 453

Human   612 CFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIF 676
            .:|::|....||||.|.|.|:|.|||.|::::...||.:.:|::||..||.|||..||||.|..:
  Fly   454 LYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRY 518

Human   677 WKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAP 741
            |:|||.||.|..|.||..:....:||:||..|.||:|:..|||.:...||:.||.:.:.|:...|
  Fly   519 WQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWANALGWCIAGSSVVMIPAVAIFKLLSTP 583

Human   742 GRFIERLKLVCSPQPD 757
            |...:|..::.:|..|
  Fly   584 GSLRQRFTILTTPWRD 599

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 271/580 (47%)
DATNP_001261026.1 SLC6sbd_SERT-like_u1 27..597 CDD:271405 270/576 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.