DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and bdg

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_611064.2 Gene:bdg / 36747 FlyBaseID:FBgn0034049 Length:1331 Species:Drosophila melanogaster

Alignment Length:898 Identity:191/899 (21%)
Similarity:326/899 (36%) Gaps:245/899 (27%)


Human    37 EQELPAAAAPPPPRVPRSASTGAQTFQSADARACEAERPGVGSCKLS---------SPRAQAASA 92
            |.::|......|||  |.|.. .:.|...|.:|..|  |.|||..|:         ...|:|:|.
  Fly   312 EDDIPTLLVELPPR--RDAEM-RRCFSQGDCQASVA--PTVGSQMLTEAHIFDNLLQTNARASSE 371

Human    93 ALRDLREAQGAQASPPP------GSSGPGNA---LHCKIPFL---------------------RG 127
            ..|..:..:..:..|.|      ..|.|.:|   :..:.|.|                     |.
  Fly   372 EPRPRQYGRRLEGPPTPVRPLILAQSRPQSAPTRVQMREPQLQDTPTHPIMSTCSELSSARSSRM 436

Human   128 PE-----GDANVSVGKGTLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDE 187
            |.     .|:: |.|..:.|.:..|     :..|:|.:......|.:.|.....:..:|      
  Fly   437 PSPVSLPSDSS-SSGSSSAEHDQEP-----DPVQTTTMCSASSTTPLEPLHQLQLLLRE------ 489

Human   188 NKARGN--WSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVS 250
             |...|  |.......|:::|..:|:.|:.||..|.. |.||.||:.:|::..:.|:|:.:|::.
  Fly   490 -KCGFNSQWPHAGSRTLALIGCTLGVFNMCRFAVLTI-NFGGNFLLQFLLLSVIFGIPLLWLQMC 552

Human   251 LGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPW 315
            ||.....||||:||..|...|.|||:::....:|:|..|.:.:.|.||...|.:....|   ..|
  Fly   553 LGAKIRAGPVSMWKISPICAGVGIALVMQQCFLALYSTVSLAWILVYLRDVFPTAARSG---YRW 614

Human   316 NTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYP-NVTMVNFTSQANKTFVSGSEEYFKYFV 379
            ..                               .|:| .....|.|....:|..    |||...|
  Fly   615 QE-------------------------------MAFPYRYDASNATGNLTQTVA----EYFNVVV 644

Human   380 LK--------ISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVIL 436
            |:        .::||.:....| .||..|.|.|..|:..|.||:|:.||:.|...|.|.|.|.::
  Fly   645 LQRLHLANHPDASGIRFHVNDR-QLAFYLALIWAAVFLILCKGLKSLGKLAYIIYTLPLVALAVV 708

Human   437 LIRGVTLPGAGAGIWYFITPKW-----------EKLTDATVWKDAATQIFFSLSAAWG--GLITL 488
            ..:.|          |.:.|..           :.|.::..|..|..:.|.:    ||  |...:
  Fly   709 TAKFV----------YVVDPSRIQNIFAASDFDDFLVNSNSWTAATQETFLT----WGLLGASVI 759

Human   489 SSYNKFHNNC-----YRDT-LIVTCTNSATSIFA-------------GFV--------------I 520
            :..::.|.|.     .||. |:|..|.....:.|             |:|              |
  Fly   760 AITSRSHTNANKAALRRDAILLVLFTLIGLGLMALLALCCAQILWQHGYVYVPGSFENPDCYTSI 824

Human   521 FSV----------------------IG--FMANERKVNIENVADQGPGIAFV--VYPEALTRL-- 557
            :|:                      ||  :..|...:::|:...   .:.|:  ::|..|:..  
  Fly   825 YSLQSNTNPYLLSYPRSLIPHYSSFIGETYRRNRTMIHVESGFQ---ALRFISEIFPAVLSLASD 886

Human   558 PLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMIT 622
            .:|..||.:.|......||..:....:.|.:::.:.....|.:         |:...::..|..|
  Fly   887 SISWVWAAVAFATFAGFGLAQLCVMWKPISSALGNSTSSVLLS---------CVTGLLLSIPFAT 942

Human   623 QGGIYMFQLVD-TYAASYALVIIAIFELVGISYVYGLQ----------RFCEDIEMMIGFQPNIF 676
            :.||.:...|| ....|:.:.||...::.|:..:.|..          |.|..:...:....|:.
  Fly   943 EMGISILYYVDFLLGGSWFIPIIWTAQIFGVFLIRGRPYNGDDLVNDLRLCGSMSAFLALSWNVL 1007

Human   677 WKVCWAFVTPTILTFILCFS--FYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKM-- 737
            ..:  ..:|.:::.:....|  ||.|...:|.:|    ||..:|.|:....::.||:..:|::  
  Fly  1008 LPI--GLITLSVVDYKASLSNQFYYWRGKSYFTY----WSRKMGSLIQIGVLLVIPVTAIIQIYR 1066

Human   738 HLA--PGRFIERLKLVCSPQPDWG-----PFLAQHRGERYKNMIDPLGTSSLG 783
            :||  |...:||::|:..| |:.|     |...|...:..:|   .||.::.|
  Fly  1067 YLAHGPPDILERIQLLYRP-PEEGEEPRRPSARQTASQSRRN---ALGQTTEG 1115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 151/701 (22%)
bdgNP_611064.2 SLC5-6-like_sbd 501..976 CDD:271356 116/541 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.