DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC6A5 and CG8850

Sequence 1:NP_004202.3 Gene:SLC6A5 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster

Alignment Length:630 Identity:222/631 (35%)
Similarity:344/631 (55%) Gaps:53/631 (8%)


Human   164 DGITSVLPGSVATVATQEDEQGDENKA-RGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGG 227
            |||::|:..:.....|...|...|:.. |..||..::|:.|.:..:||||||||||::|.:||||
  Fly    29 DGISTVIYSAEGEELTINCEAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGG 93

Human   228 AFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIIC 292
            ||||||:::|.|.|.|:::|||.:|||:|:|.:..:...|.::|.....:..:.|...||..|:.
  Fly    94 AFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRGIAYGQVYSTALATTYYACIMA 158

Human   293 YTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMV 357
            .|:.||.|||..||||..|...|.            .|||.:                  ..|..
  Fly   159 LTIRYLVASFSEVLPWTYCLVEWG------------KSCVAT------------------GATAA 193

Human   358 NFTSQANKTFVSGSEEYFKYFVLKISAGIEYP--GEIRWPLALCLFLAWVIVYASLAKGIKTSGK 420
            |.:|....  ||.:|.:|...||:....::..  |...|.|.|||...|||:...|:|||::|||
  Fly   194 NDSSIVQG--VSSAELFFTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKGIRSSGK 256

Human   421 VVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGL 485
            ..||.|.||||::::||||.||||||..||.||:.|:|.:|.:..||..|.||:||||:..:|.|
  Fly   257 ASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTL 321

Human   486 ITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVV 549
            :..:|:|.|:.|.::|.:|:|..:|.|||.||.:||.::|.:|.|... :|..|...|.|:||:.
  Fly   322 VMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFIS 386

Human   550 YPEALTRLPLSP-FWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKP--VFTLGCCI 611
            ||||:.:....| .:|::||.|||.||:.:.......:|..:.|.|     ||.|  :..:...|
  Fly   387 YPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRF-----THLPHWLLAVSASI 446

Human   612 CFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIF 676
            ..|:.|...:|.||.::..|||.|..::..:::||.||:.:.::||::|.|.|||.|:..:.:.:
  Fly   447 IGFLCGLVYMTPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDIEFMLNVKTSFY 511

Human   677 WKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAP 741
            |::|||.|.|.::..:|.:..:.:||:||...:||....:.||::....|:.:|...::.::..|
  Fly   512 WRICWAIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYYMAGWIIWGLGVLQLPFWALVTIYQQP 576

Human   742 GR-FIERLKLVCSPQPDWGPFLAQ-------HRGERYKNMIDPLG 778
            |: |..:..|...|..:|||...|       || :|..:...|.|
  Fly   577 GKTFGSKFGLAMQPTANWGPLQTQKFEAYIIHR-KREADFKSPRG 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 215/603 (36%)
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 190/511 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107584638
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.