DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and CG1698

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_001260835.1 Gene:CG1698 / 36006 FlyBaseID:FBgn0033443 Length:654 Species:Drosophila melanogaster

Alignment Length:668 Identity:236/669 (35%)
Similarity:360/669 (54%) Gaps:91/669 (14%)


Human   113 GPGNALHCKIPFLRGPEGDANVSVGKGTLER--NNTPVVGWVNMSQSTVVLGTDGITSVLPGSVA 175
            |..||....||....|...:|   ||.||..  .:.|..|..:.                |..| 
  Fly    21 GSLNASTISIPGAYKPNESSN---GKKTLSEGSGSAPPPGHGDS----------------PSGV- 65

Human   176 TVATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALA 240
                   |.|...|.|.:|::.::|::|.:..:||||||||||:.|.:||||||:||||::|.|.
  Fly    66 -------EAGQPGKKRDSWNNDIEFLMSCIALSVGLGNVWRFPFTALENGGGAFVIPYLIVLILV 123

Human   241 GLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSV 305
            |.|:::||:.||||:|:|.|.|:...|.::|.|...::.:.::..||..::..||.|...||...
  Fly   124 GKPVYYLEMLLGQFSSRGSVKVYDFSPIMRGIGYGQVLATGIVTTYYATLMALTLRYFVDSFYPT 188

Human   306 LPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSG 370
            |||..|...|.| ||       |||     .|:                      ..:..|.::|
  Fly   189 LPWSYCREEWGT-EC-------LDS-----GPQ----------------------EASRATSLAG 218

Human   371 S-------EEYFKYFVLK----ISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYF 424
            |       |.||...:|:    |..||.||.   |.|||.|.:||:::...:.||:|:|||..||
  Fly   219 SGVRTTSAEFYFTNIILREKASIDDGIGYPS---WSLALALAVAWIVIAGIMFKGVKSSGKASYF 280

Human   425 TATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLS 489
            .|.|||||:::||:|.:|||||..|:.||:.|:|.||.:..||..|.||:||||:..:|.:|..:
  Fly   281 LALFPYVVMLVLLVRALTLPGAFDGVLYFLRPQWHKLLEPQVWYAAVTQVFFSLAICFGNIIMYA 345

Human   490 SYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERK-VNIENVADQGPGIAFVVYPEA 553
            |||:|.:|.|||..|||..::.||:.:|.:||.::|.:|.|.. .:|.:|.:.|||:||:.||:|
  Fly   346 SYNRFGHNIYRDANIVTTLDTFTSLLSGVIIFGILGNLAYENNTTDIASVVNGGPGLAFISYPDA 410

Human   554 LTRLPLSP-FWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMG 617
            :.:....| .::::|||||..||:.:.......:.|.|.|:| .:|:....|  :|..|..:.:|
  Fly   411 IAKFKWLPQLFSVLFFLMLFVLGIGSNVGMASCMSTVIKDQF-GHLKNWTVV--VGIAIVGYFLG 472

Human   618 FPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWA 682
            ...||.||.::..|||.:..::..:::||||||.|:::||::|.|.|:|.|||.:.::::::|||
  Fly   473 LLYITPGGQFLLNLVDYFGVTFVALVLAIFELVTIAWIYGVKRLCRDVEFMIGIKTSLYYRICWA 537

Human   683 FVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSV----IW-IPIMFVIKMHLAPG 742
            .|||.::..||.::...:||:.|..|.|.:...|.||.:.|..|    .| ||.:.....||.  
  Fly   538 VVTPLLMLTILIYTLVLYEPLKYKDYTYQSGVYVFGWCLSAFGVGQVLFWAIPAVRKQPSHLG-- 600

Human   743 RFIERLKLVCSPQPDWGP 760
             ...|::....|.|:|||
  Fly   601 -LWARIRKAFEPLPNWGP 617

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 218/589 (37%)
CG1698NP_001260835.1 SLC6sbd 75..552 CDD:271359 196/518 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107584555
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.