| Sequence 1: | NP_004202.4 | Gene: | SLC6A5 / 9152 | HGNCID: | 11051 | Length: | 797 | Species: | Homo sapiens | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_609726.1 | Gene: | CG15279 / 34863 | FlyBaseID: | FBgn0028886 | Length: | 639 | Species: | Drosophila melanogaster | 
| Alignment Length: | 659 | Identity: | 232/659 - (35%) | 
|---|---|---|---|
| Similarity: | 367/659 - (55%) | Gaps: | 60/659 - (9%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
Human   140 TLERNNTPVVGWVNMSQSTVVLATDGITSVLPGSVATVATQEDEQGDENKA------RGNWSSKL 198 
Human   199 DFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVW 263 
Human   264 KAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPW------NTPECKD 322 
Human   323 KTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVL----KIS 383 
Human   384 AGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGA 448 
Human   449 GIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATS 513 
Human   514 IFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVVYPEALTRLP-LSPFWAIIFFLMLLTLGL 576 
Human   577 DTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYAL 641 
Human   642 VIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYG 706 
Human   707 SYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFI-ERLKLVCSPQPDWG---PFLAQHRG 767 
Human   768 ERYKNMIDP 776  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| SLC6A5 | NP_004202.4 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..118 | ||
| SLC6sbd_GlyT2 | 191..787 | CDD:271389 | 223/602 (37%) | ||
| CG15279 | NP_609726.1 | SLC5-6-like_sbd | 50..598 | CDD:294310 | 216/575 (38%) | 
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0733 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D250396at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR11616 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.920 | |||||