DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and CG15279

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_609726.1 Gene:CG15279 / 34863 FlyBaseID:FBgn0028886 Length:639 Species:Drosophila melanogaster

Alignment Length:659 Identity:233/660 (35%)
Similarity:368/660 (56%) Gaps:60/660 (9%)


Human   140 TLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKA------RGNWSSKL 198
            |.:||:          |:...:|.||.::.....::|.:....:..|:.:|      |..|...:
  Fly     3 TTQRNH----------QNLAFVGDDGRSTASTVEISTNSPALRDNSDDQEAAKVPEERATWGKGV 57

Human   199 DFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVW 263
            :|::|.:..:||||||||||:.|..|||||||||||::|.|.|.||::||:.:|||:|:|.|.|:
  Fly    58 EFLMSCIAMSVGLGNVWRFPFTALDNGGGAFLIPYLIVLFLIGKPIYYLEMVIGQFSSRGSVKVF 122

Human   264 KAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPW------NTPECKD 322
            ...||::|.|........:::.||..::.....|...||.:.|||.:|...|      :.|:..:
  Fly   123 DLCPAMKGVGAGQAFQVFMLSTYYAALVAIIGRYFIESFRNPLPWSTCRAEWGIHCINSAPDASN 187

Human   323 KTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVL----KIS 383
            .::|      .|:..:.|            |.||    ...|...::.||.||...||    .|.
  Fly   188 WSQL------ESNDQRPQ------------NYTM----KSQNDRVITSSEWYFVKEVLHEKPNIE 230

Human   384 AGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGA 448
            .||..|   .|.|.:.||:||..|:..:.:|:|:|||..||.|.||||::.:||:|.|||||:..
  Fly   231 EGIGLP---NWELVIGLFIAWSCVFFIIRRGVKSSGKASYFLALFPYVIMGVLLVRAVTLPGSID 292

Human   449 GIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATS 513
            ||:|||.|:|.|:.|..||..|.||.|:|||..:|.:|..||:|||.:|.:||..|||..::.||
  Fly   293 GIYYFIKPQWGKILDPKVWYAAVTQCFYSLSVCFGNIIMYSSFNKFGHNVHRDAAIVTGLDTMTS 357

Human   514 IFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVVYPEALTRLP-LSPFWAIIFFLMLLTLGL 576
            :.|||.||.::|.:|:|... :|.:|...|.|:||:.||:|:.:.. |...::::|||||..||:
  Fly   358 LLAGFTIFGILGHLAHEIGTDDIGSVVKGGAGLAFISYPDAIAKFKNLPQIFSVLFFLMLFVLGI 422

Human   577 DTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYAL 641
            .:..|.....||:|.|.||.:.:..   .:|...:..|.:|...||.||.||..|||.:.||...
  Fly   423 GSNIAMTSCSVTAIRDRFPNFGQWQ---CSLLIAVVSFFIGLMYITPGGQYMLTLVDFFGASMIA 484

Human   642 VIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYG 706
            :::.|.||..|.::||..|.|:|||.|:|.:..::|::||:.:||.|:|.||.:.:..::|:||.
  Fly   485 LVLGIAELYTIGWIYGTDRLCKDIEFMLGRKVGLYWRLCWSIITPLIMTVILIYFYATYQPLTYN 549

Human   707 SYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFI-ERLKLVCSPQPDWG---PFLAQHRG 767
            :..|||||..:|||:.|..::.:||..::.:...||:.: .:::...:|:.:||   |.|.:...
  Fly   550 NIVYPNWSYSIGWLITAFGILQLPIWMIVAIVRDPGQTLGAKIRGAFTPKKNWGPSDPLLREQYH 614

Human   768 ERYKNMIDP 776
            :..:|.:.|
  Fly   615 KEIENELTP 623

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 223/603 (37%)
CG15279NP_609726.1 SLC5-6-like_sbd 50..598 CDD:294310 216/576 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107584458
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.