DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and CG13796

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_001137807.1 Gene:CG13796 / 34051 FlyBaseID:FBgn0031939 Length:641 Species:Drosophila melanogaster

Alignment Length:627 Identity:158/628 (25%)
Similarity:256/628 (41%) Gaps:136/628 (22%)


Human   188 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQ--------NGGG-AFLIPYLMMLALAGLP 243
            :|.||.|:...||..:...:|        |..|.|.        :||. .|:|.|||.:....||
  Fly    81 DKCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLP 137

Human   244 IFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPW 308
            ||.::..||||:|.|.:|.::..|..:|.|.|:|::::....||::.....|.|...|...|:||
  Fly   138 IFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPW 202

Human   309 GSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEE 373
            .||||.|||.||.......:|...:..|..::...|....||..:.:|                 
  Fly   203 MSCNNSWNTQECSLHENYDVDDYRVDPHSTVEFFRSMIASTAKGSTSM----------------- 250

Human   374 YFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVV---------YFTATFP 429
                             .|.|.:.:.:...|::|.|.|.|.:...|||:         :|.|.|.
  Fly   251 -----------------SISWSMLIGVLSIWLVVLALLLKPVAFIGKVLRCSCVLMFGFFVAVFL 298

Human   430 YVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFF---SLSAAWGGLITLSSY 491
            |    :|:...||..    .:.|:..|:.:...  ::...|.|.:..   :|...||.:||||||
  Fly   299 Y----LLIHEQVTFD----TLHYYWMPQLDSFD--SILATARTALLMAGGALGPGWGSIITLSSY 353

Human   492 NKFHNNCYRDTLIVTCTNSATSIFAGFVIFSV--------IGFMA--NERKVNIENVADQGPGIA 546
            |.|..:..|.::.| |....|....|.:..:|        :|.|.  .:.|.:::        ..
  Fly   354 NNFRRDAERLSIWV-CLTHITIGLMGLLCCNVAHDHFEDHVGMMPLHVDEKHHMQ--------FL 409

Human   547 FVVYPEALTRLPLSP-FWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHK------PV 604
            ::.:.....|...:| .||.:||.|:....|..:...:.:::|::.||| :.||:.:      .|
  Fly   410 YLCFSYLFGRFTTTPNLWAFLFFGMIFLSELCALIIQMMSVITALFDEF-ETLRSRRILVISSLV 473

Human   605 FTLGCCICFFI--MGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEM 667
            |.|.....:|.  :||..:||        :...|....|:|..|..|: .::|||..||..|::.
  Fly   474 FCLTASSVYFCTQLGFSQLTQ--------LPNLAVFTHLLISGILVLM-TTWVYGRVRFQCDLQF 529

Human   668 MIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYR--------YPNWSMVLGWLMLAC 724
            |:|...:.|......|.||..|.  ||  .:|   :||...|        |.:..::   |:.|.
  Fly   530 MLGKTISSFKIFFIRFATPIFLG--LC--LFQ---LTYLFTRDRIHDVLIYVSQGLI---LLTAI 584

Human   725 SVIWIPIMFVIKMHLAPGRFIERLKLVCSPQPDWGPFLAQHR 766
            |.:      |.|:....|.:.:||:...:|. ||.|..|.:|
  Fly   585 SYM------VYKVCRTNGDWRQRLQQCLAPH-DWHPVDADNR 619

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 157/625 (25%)
CG13796NP_001137807.1 SLC5-6-like_sbd 123..610 CDD:294310 141/567 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103639448
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.