DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and CG13795

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_001285712.1 Gene:CG13795 / 34049 FlyBaseID:FBgn0031937 Length:594 Species:Drosophila melanogaster

Alignment Length:609 Identity:156/610 (26%)
Similarity:274/610 (45%) Gaps:74/610 (12%)


Human   191 RGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFA 255
            ||.|....||:.:..|.|:.| :|:...:..|.:.|...::||.:.:::..:||..:...:|||:
  Fly    20 RGKWDKPTDFMFACFGLALKL-DVFVASFWMFFDMGILGILPYFVYMSIYLVPIMVIHSFMGQFS 83

Human   256 SQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCN--NPWN-- 316
            |.|.:|.::..|..:|.|.....:::.:.|||::.....|.::..||...||| ||.  :.|:  
  Fly    84 SSGFISAFRLSPFFKGMGYVSGFLTISMLIYYSIFAAVPLLFIINSFRPTLPW-SCEGLSSWHNG 147

Human   317 ----TPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKY 377
                :..| :||.:|.|   .|::      |.:..:...|:|  :.|.:..:........:::|.
  Fly   148 SATLSSSC-NKTLILED---FSEY------NRSHQLLHVPSV--LYFQNHYDSMQQDAVPDWYKD 200

Human   378 FVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTS--GKVVYFTATFPYVVLVILLIRG 440
            :            |:.|.......:.||::.....|..:|:  ||::.:......|:|::..:|.
  Fly   201 Y------------ELSWHFVGLFAIIWVVIAFIFYKFSETAKFGKLIRYMVIVTLVLLLVCFVRF 253

Human   441 VTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIV 505
            :.||||..|:..::|||...:....|  .....:..:..|.||.:|||||:|.|..:....:.|:
  Fly   254 LFLPGALNGLHRYVTPKASDMAMGVV--STFIMVLHAFGAGWGSVITLSSFNGFKTDIMSYSWII 316

Human   506 TCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIA-FVVY---PEALTRLPLSPFWAII 566
                |...||. :::|.::.||.......:.:|.|.|..:: :::|   ..||:.:.....|..|
  Fly   317 ----SFGQIFI-YIMFGMVSFMLEHYFNELSDVDDNGHVLSHWLLYLSSASALSTMAWPNLWTFI 376

Human   567 FFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQL 631
            ::.|||...|..|...|.|::.|:.||| :.||..|...|.|......:..|...|..||..|. 
  Fly   377 YYSMLLIAALIVMTTQIFTVLQSLFDEF-EVLRVRKQEVTFGLIGGIALCSFYFCTNHGIIFFS- 439

Human   632 VDTYAASYALVIIAIFE--------LVGISYVYGLQRFCEDIEMMIGFQPNIFWKV-CWAFVTPT 687
                    ||.:.|||.        |:.:.::||.:||..|||.|:| ||...||| ...|:.|.
  Fly   440 --------ALGLDAIFSHSLLHLLLLLVVLWIYGRERFQRDIEFMLG-QPFASWKVFILRFIAPI 495

Human   688 ILTFILCFSFYQWEPMTYGSYRYPNWSM-VLGWLMLACSVIWIPIMFVIKMHLAPGRFIERLKLV 751
            ||...|....    .::...:.|....: |:..:::...::.||......::.:.|.|.||.|..
  Fly   496 ILVICLLAGI----ALSISEHSYSTTVVFVMSIVLVVLPILAIPGYGFYYLYQSTGTFCERFKRT 556

Human   752 CSPQPDWGPFLAQHRGERYKNMID 775
            |.| .||.|...:|| ::|:..:|
  Fly   557 CRP-TDWYPVEMEHR-QQYEEAVD 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 156/610 (26%)
CG13795NP_001285712.1 SLC5-6-like_sbd 27..505 CDD:271356 135/522 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103639294
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.