DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and CG13794

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_609137.2 Gene:CG13794 / 34048 FlyBaseID:FBgn0031936 Length:595 Species:Drosophila melanogaster

Alignment Length:607 Identity:160/608 (26%)
Similarity:270/608 (44%) Gaps:68/608 (11%)


Human   191 RGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFA 255
            ||.|....|:|.:..|.|:.| :::...|..|.:.|...::|||:.:.:..:||..:...:|||:
  Fly    20 RGKWDKPTDYIFACFGLALKL-DIFVASYWFFFDMGIFGMLPYLVYMVIYLVPIMVIHSFMGQFS 83

Human   256 SQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCN--NPW-NT 317
            |.|.:|.::..|..:|.|...:.:::.:.|||::.....|.::..||...||| ||.  ..| |.
  Fly    84 SSGFISAFRLSPFFKGMGYVSVFLTISMLIYYSIFAAVPLLFMINSFRPTLPW-SCEGFKSWYNE 147

Human   318 PECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKI 382
            .:.|..|..:..|..::|:..   .|:.|....:...:::.|.    |.|.|..||.:       
  Fly   148 SDGKMTTCNMTISEDLTDNSD---NNTDFHRPHFHVPSVLYFL----KHFESVQEENY------- 198

Human   383 SAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTS--GKVVYFTATFPYVVLVILLIRGVTLPG 445
             :.:....::.|.......|.|.:|.....|..:|:  ||.:.:......::|::...|.:.|||
  Fly   199 -SDLRQDYDLSWRFVSLFVLVWAMVAFIFYKFSETAMFGKFIRYMVIGTLILLLVCFGRFLFLPG 262

Human   446 AGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNS 510
            |..|:..::||..:::  |.........:..:..|.||.:|.|||:|.|..:....:.|:    |
  Fly   263 ALLGLRKYVTPSPDEI--AMGIGSTFVMVLHAFGAGWGSVIALSSFNGFKTDIMSYSWII----S 321

Human   511 ATSIFAGFVIFSVIGFMA----NERKVNIENVADQGPGIAFVVY---PEALTRLPLSPFWAIIFF 568
            ...||. |.:|.::.:|.    ||   .||...|:.....:.:|   ..||:.|.....|..|::
  Fly   322 FGQIFI-FTMFGLVSYMLDHYYNE---GIEGSFDKQVLTHWALYLSSATALSSLGWPNLWTFIYY 382

Human   569 LMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVD 633
            .|||...|..:...|.|::.|:.||| :.||..|...|.|......:..|...|..||..|.   
  Fly   383 TMLLMAALIVITTQIFTVLQSLFDEF-EVLRVRKQEVTFGLIGGIAVCSFYFCTNHGITFFS--- 443

Human   634 TYAASYALVIIAIFE--------LVGISYVYGLQRFCEDIEMMIGFQPNIFWKV-CWAFVTPTIL 689
                  ||.:.|||.        |:.:.::||.:||..|||.|:| ||...||| ...|:.|.||
  Fly   444 ------ALALDAIFSHSLLHLLLLLVVLWIYGRERFQRDIEFMLG-QPFASWKVYILRFIAPIIL 501

Human   690 TFILCFSFYQWEPMTYGSYRYPNWSMVLGW--LMLACSVIWIPIMFVIKMHLAPGRFIERLKLVC 752
            ...|.....    :.|..:.|.: ::|||.  :::...::.||...:..::.:.|.|.||.|..|
  Fly   502 IICLVVGIL----VCYMEHIYSS-AIVLGMSIILVILPILAIPGYGIYYIYRSTGSFCERFKRTC 561

Human   753 SPQPDWGPFLAQHRGERYKNMI 774
            .| .||.|...:|| ::|:..:
  Fly   562 RP-TDWYPVEMEHR-QQYEEAV 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 160/608 (26%)
CG13794NP_609137.2 SLC5-6-like_sbd 27..509 CDD:271356 137/520 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103639333
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.