DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and CG13793

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_609136.2 Gene:CG13793 / 34047 FlyBaseID:FBgn0031935 Length:583 Species:Drosophila melanogaster

Alignment Length:610 Identity:156/611 (26%)
Similarity:265/611 (43%) Gaps:81/611 (13%)


Human   191 RGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFA 255
            ||||....|:|.:..|.|:.| :::...:..|.|.|...::||||.:.:..:||..:...:|||:
  Fly    12 RGNWEKPTDYIFACFGLALKL-DIFVASFWFFFNTGIFGMVPYLMYMVIYLVPIMVIHSYMGQFS 75

Human   256 SQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCN--NPWNTP 318
            |.|.:|.::..|..:|.|...|.:::.:.|||.:.....|.::..||...||| ||.  ..|...
  Fly    76 SSGFISAFRLSPLFKGMGYVSLFLTITLLIYYTIFAAVPLLFVLNSFRPTLPW-SCEGFKSWQND 139

Human   319 ECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSE--EYFKYFVLK 381
            ..   .|..:.:..|::....:.:|.|:......:|..|.:.....::|.:.||  :|       
  Fly   140 TI---AKWSICNATIAEEVAKETENDTYFYITNIHVPSVLYFKSHFESFQNDSELNDY------- 194

Human   382 ISAGIEYPGEIRWPLALCLFLAWVIV------YASLAKGIKTSGKVVYFTATFPYVVLVILLIRG 440
                     ||.|.|:....|.|..:      ::..||    .||.:.:.......:|::..:|.
  Fly   195 ---------EISWHLSGLFALVWATIAFIFYKFSEPAK----FGKCIRYMVIGTVALLLVCFVRF 246

Human   441 VTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFF--SLSAAWGGLITLSSYNKFHNNCYRDTL 503
            :.||||..|:..::||..|:....|    ::|.|..  :..|.||.:|||||:|.|..|....:.
  Fly   247 LFLPGAHLGLKNYMTPSIEEFVVGT----SSTFIMALQAFGAGWGSVITLSSFNGFKTNIMSYSW 307

Human   504 IVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQ----GPGIAFVVYPEALTRLPLSPFWA 564
            |:    |...||. :::|.::.||.....:.:.....:    ...:.|:....||:.|.....|.
  Fly   308 II----SFGQIFI-YIMFGMVSFMLEHYFLGLPKPLFETQVINHWVLFLSSASALSSLGWPNLWT 367

Human   565 IIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLG------CCICFFIMGFPMITQ 623
            .|::.|||...|..:...|.||:.|:.||| :.||..|...|||      .|..:|      .|.
  Fly   368 FIYYTMLLMAALIVITTQIFTILQSLFDEF-EQLRAKKQEVTLGLIGGLAVCSLYF------CTN 425

Human   624 GGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKV-CWAFVTPT 687
            .|:..|.:: :..|.::..::.:..|:.:.:|||..||.:||:.|:| ||...||| ...||.|.
  Fly   426 HGVLYFAIL-SIDAIFSQTLLHLLLLLVVLWVYGRDRFQKDIKFMLG-QPFASWKVFILRFVAPP 488

Human   688 ILTFILCFSFYQWEPMTYGSYRYPNWSMVLGW---LMLACSVIWIPIMFVIKMHLAPGRFIERLK 749
            .|...|....    .|....:.|.  |.||.:   :::...::.||......:|..||...|..:
  Fly   489 TLVICLVLEI----KMCLEEHSYS--SSVLHFMAIILVGLPILAIPAYGFYYIHQRPGSISELFR 547

Human   750 LVCSPQPDWGPFLAQHRGERYKNMI 774
            ..     ||.|...::| ::|..::
  Fly   548 AT-----DWYPVEMEYR-QQYGELV 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 156/611 (26%)
CG13793NP_609136.2 SLC5-6-like_sbd 19..498 CDD:271356 136/522 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103639367
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.