DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and Ntl

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_609135.1 Gene:Ntl / 34046 FlyBaseID:FBgn0267326 Length:590 Species:Drosophila melanogaster

Alignment Length:593 Identity:236/594 (40%)
Similarity:367/594 (62%) Gaps:34/594 (6%)


Human   176 TVATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALA 240
            |.||::|::.:.::.||.|.||.:||||::|||:|:|||||||||.:::||.|||||||:|:.||
  Fly     9 TNATRKDKRIERDENRGQWKSKSEFILSLLGYAIGIGNVWRFPYLCYRSGGAAFLIPYLLMVILA 73

Human   241 GLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSV 305
            |:|:|::|:.:|||:|.|...:::..|.|:|.|||.::::.....||:|||.|.:..:|..|...
  Fly    74 GIPLFYMEILIGQFSSTGCTGMFRMTPLLKGTGIAQVVVNAYCVCYYSVIISYPIRMIFYCFFKK 138

Human   306 LPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSG 370
            :||..|:|.|||.:|          ...||..|   :||                   :..|.:.
  Fly   139 VPWEDCSNSWNTDDC----------VTASDMGK---QNS-------------------SDVFKTS 171

Human   371 SEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVI 435
            ::|:|...||:||..|...|.:.|.....|.:.|:|:|..|.:|||:.|||||||..|||::|.|
  Fly   172 ADEFFHLEVLRISTDISDLGGMVWEQLTALIITWIIIYFCLMRGIKSVGKVVYFTVPFPYLLLFI 236

Human   436 LLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYR 500
            |||||.|||||..||.:::.|:|.:|.|..||.|||.|:||.:...|||::.::|::.|.||...
  Fly   237 LLIRGATLPGAWKGIKFYLYPEWHRLLDLKVWADAAVQMFFGIGPGWGGIVNMASFSSFRNNAKC 301

Human   501 DTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAI 565
            |::::...|..||:.||||:|||:||::.:..:.:|:||..|.|:|||.||||:..||:...||:
  Fly   302 DSVLIVSINVFTSLLAGFVVFSVLGFLSEKSGIPVESVATGGAGLAFVTYPEAIALLPVPQLWAL 366

Human   566 IFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQ 630
            :||.||..||:|::|..:|.|::||.||: .::|:||...||..|:.|..:...|.|.||:::.|
  Fly   367 MFFFMLFLLGIDSVFVQLEAIMSSILDEW-YWVRSHKCKLTLISCLIFLGLSSIMCTNGGMFILQ 430

Human   631 LVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCF 695
            |.|.|:::.|:::|.:.|::.::::||::.|..|:|.|:|.:|.::|::.|..|||.|:.|||..
  Fly   431 LFDWYSSAIAVIVICLVEIIMVAWIYGIKNFMLDVEFMLGKRPTLYWRIVWQVVTPVIIIFILIT 495

Human   696 SFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFIERLKLVCSPQPDWGP 760
            |......:||.:..||.|::::||.....||:|||:.....|........:.||....|. ||.|
  Fly   496 SIVFIRTITYNNIPYPQWAIIIGWASCFTSVMWIPLYIFYIMIRKRATLCDSLKKRLKPL-DWTP 559

Human   761 FLAQHRGE 768
            ...|.|.|
  Fly   560 ADPQDRAE 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 232/579 (40%)
NtlNP_609135.1 SLC5-6-like_sbd 24..554 CDD:294310 225/563 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128673
Panther 1 1.100 LDO PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.