DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and ine

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_001162871.1 Gene:ine / 33659 FlyBaseID:FBgn0011603 Length:943 Species:Drosophila melanogaster

Alignment Length:865 Identity:285/866 (33%)
Similarity:435/866 (50%) Gaps:151/866 (17%)


Human    14 ANSPEAAAAQG---------HPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQTFQSADARA 69
            ||.|.||.:..         :.:|...|        .||:.|.|..:|..:.|.|       ...
  Fly   129 ANQPTAAVSTSTVTFTIDDCNEEGDAIP--------AAASVPAPVTMPAISPTPA-------TLT 178

Human    70 CEAERPGVGSCKLSSP-------RAQAASAALRDL--------------------REAQGAQASP 107
            |.......|.....||       |..:..:::|.:                    ....|.||..
  Fly   179 CTTTTTMAGDSVAVSPLSMELKSRLGSHHSSMRSVVSGYLPGLSDSSGNLVGGVSMATSGLQAPN 243

Human   108 P---------PGSSG-----PGNALHCKIPFLRGPEGDANVSVG-----KGTLERNNTPVVGWVN 153
            |         .|||.     .||.::..:..:|..   |::.:|     |..:.|..|......:
  Fly   244 PLYMQPQASLSGSSYHFHELAGNQIYSDVTSVRSL---ASIGIGSTDGRKLVIRRVPTTANELFD 305

Human   154 M--SQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWR 216
            |  .|:...||.|...|.|..|        ||.......:.:|::|:.|:|:.:||:||||||||
  Fly   306 MVNPQTPPPLGVDDDDSYLDMS--------DETAQLKPRQQHWANKMQFVLACIGYSVGLGNVWR 362

Human   217 FPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPV-SVWKAIPALQGCGIAMLIIS 280
            |||:.:::|||.||:||.::|.:..:|:.|:|:|:||:..:||: ::.:..|..:|.|:|.:::|
  Fly   363 FPYMCYKSGGGVFLVPYCIILFICSIPLLFMELSVGQYTGRGPIGALGQLCPLFKGAGLASVVVS 427

Human   281 VLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNST 345
            .|::.||:|||.|:::|.|.||.:.:||..|||.||||:|                         
  Fly   428 FLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDC------------------------- 467

Human   346 FCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYAS 410
                ..|....:|  :.|..|..:.|||:|:..||:||.|:||||.:||.|..||..||::||.:
  Fly   468 ----WVPQRKGIN--ASAPDTSRTPSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFA 526

Human   411 LAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIF 475
            ..|.||:|.||.|||||||:|:::||::|.|||.||..|:.:|..|||.:|.:|.||.:||:|.|
  Fly   527 TWKSIKSSAKVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWINAASQNF 591

Human   476 FSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVAD 540
            .||...:|.:|:.:||||::||..|||:.|:..|..||:..|...||.:|.:|.|:..|:.:|..
  Fly   592 NSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIFAFSTLGNLALEQNTNVRDVIG 656

Human   541 QGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTH---K 602
            .|||:.|||||:|:.::|.:..||::||.|||.|||::.||.:|.:||||.|.||::::.|   .
  Fly   657 DGPGMIFVVYPQAMAKMPYAQLWAVMFFFMLLCLGLNSQFAIVEVVVTSIQDGFPRWIKRHLGYH 721

Human   603 PVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEM 667
            .:..|..|:...:.|.|.|.|||||.|||:|.||||..::.:|..:::.|::.||..|..::::.
  Fly   722 EIVVLFVCVISCLFGMPNIIQGGIYYFQLMDHYAASVTIMFLAFCQMIAIAWFYGTGRLSKNVKQ 786

Human   668 MIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTY--GSYRYPNWSMVLGWLMLACSVIWIP 730
            |.|..|:.:.:.||..:.|.:|..|...|...:...||  |.|.||:|:..:||:..:.|:|.||
  Fly   787 MTGKAPSFYLRSCWLVLGPCLLFAIWVLSLINYHEPTYHNGRYTYPDWAYGIGWMFASFSLICIP 851

Human   731 IMFVIKMHLAPG-RFIERLKLVCSPQ----------------PDWGPF-LAQHRGERYKNMIDPL 777
            ...||....:.| .|.||::....|.                |:...| |||.....||.....|
  Fly   852 GYAVINFLRSSGDTFWERIRNTLRPNIYECKICGEHHCEHDYPEQEQFMLAQEMATVYKPTNPHL 916

Human   778 GTSSLGLKLPVKDLELGTQC 797
                         |.||.:|
  Fly   917 -------------LNLGQKC 923

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 236/620 (38%)
ineNP_001162871.1 SLC5-6-like_sbd 337..876 CDD:294310 227/570 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103639515
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.