DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and CG31904

DIOPT Version :10

Sequence 1:NP_004202.4 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:142 Identity:50/142 - (35%)
Similarity:72/142 - (50%) Gaps:17/142 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   188 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQ--------NGGG-AFLIPYLMMLALAGLP 243
            :|.||.|:...||..:...:|        |..|.|.        :||. .|:|.|||.:....||
  Fly    81 DKCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLP 137

Human   244 IFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPW 308
            ||.::..||||:|.|.:|.::..|..:|.|.|:|::::....||::.....|.|...|...|:||
  Fly   138 IFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPW 202

Human   309 GSCNNPWNTPEC 320
            .||||.|||.||
  Fly   203 MSCNNSWNTQEC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118
SLC6sbd_GlyT2 191..787 CDD:271389 49/139 (35%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 38/92 (41%)
Cuticle_4 276..344 CDD:464954
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.