DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and CG31904

DIOPT Version :9

Sequence 1:NP_004202.4 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:142 Identity:50/142 - (35%)
Similarity:72/142 - (50%) Gaps:17/142 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   188 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQ--------NGGG-AFLIPYLMMLALAGLP 243
            :|.||.|:...||..:...:|        |..|.|.        :||. .|:|.|||.:....||
  Fly    81 DKCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLP 137

Human   244 IFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPW 308
            ||.::..||||:|.|.:|.::..|..:|.|.|:|::::....||::.....|.|...|...|:||
  Fly   138 IFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPW 202

Human   309 GSCNNPWNTPEC 320
            .||||.|||.||
  Fly   203 MSCNNSWNTQEC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118
SLC6sbd_GlyT2 191..787 CDD:271389 49/139 (35%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 38/92 (41%)
Cuticle_4 276..344 CDD:292577
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.