DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A5 and CG10804

DIOPT Version :8

Sequence 1:NP_004202.3 Gene:SLC6A5 / 9152 HGNCID:11051 Length:797 Species:Homo sapiens
Sequence 2:NP_001138150.1 Gene:CG10804 / 31317 FlyBaseID:FBgn0029663 Length:726 Species:Drosophila melanogaster

Alignment Length:732 Identity:261/733 (36%)
Similarity:380/733 (52%) Gaps:149/733 (20%)


Human    96 DLREAQGAQASPPPG-SSGPGNALHCKIPFLRGPEGDANVSVGKGTLERNNTPVVGWVN------ 153
            :|||.:|...|...| |.....:||                         :.|:.|..|      
  Fly    28 ELRELRGRLVSKEHGVSHHHHTSLH-------------------------HQPLYGATNQGFMSD 67

Human   154 -------MSQSTVVLGTDGITSVLPGSVATVATQEDEQGD------ENKARGNWSSKLDFILSMV 205
                   :.|.....|::..||.....:..:||...:|.|      |.:.|.:|.||:.|:|:.:
  Fly    68 AFDESSELEQDPPPFGSEASTSKAKAELVAIATASADQQDIVEGEKEGEERESWDSKIMFLLATI 132

Human   206 GYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAI-PAL 269
            ||||||||||||||||.:|||||||:||.:||.:.|:|||:||:::||...:|.:.||..: |.|
  Fly   133 GYAVGLGNVWRFPYLAQKNGGGAFLVPYFIMLCIQGIPIFYLELAIGQRLRKGAIGVWSQVSPYL 197

Human   270 QGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIS 334
            .|.||:..::|.::|:|||.||.:.|.||..||.|.|||..|                       
  Fly   198 GGIGISSAVVSYIVALYYNTIIAWCLIYLLHSFESPLPWADC----------------------- 239

Human   335 DHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYF--VLKISAGIEYPGEIRWPLA 397
                             |.....|||.......|:.|...|.::  .|:.|..::.|....:.:|
  Fly   240 -----------------PTRLYKNFTYDHEPECVASSPTQFYWYRTTLQCSESVDMPENFNYHMA 287

Human   398 LCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLT 462
            :.|.::|.:||..:.:||.:|||:||.||.||||||:|...||:||.||..|:.:..||:||.|.
  Fly   288 IALIVSWFLVYICMVQGITSSGKIVYMTAIFPYVVLIIFFFRGITLKGAADGVAHLFTPRWETLL 352

Human   463 DATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFM 527
            |..||.:|.|||||||..|:||||..||||..:||||||.::|:.||..||:|||.|:||||||.
  Fly   353 DPVVWLEAGTQIFFSLGLAFGGLIAFSSYNPANNNCYRDAILVSLTNCGTSMFAGVVVFSVIGFK 417

Human   528 AN---------------ERKVNIENVAD---------QGPGIAFVVYPEALTRLPLSPFWAIIFF 568
            |.               :.|.:...|.|         .|.|:||:::.||:.:.|.:..||::||
  Fly   418 ATATFDRCTEERNGLVAQNKTHNLPVCDLQTELANSASGTGLAFIIFTEAINQFPGAQLWAVLFF 482

Human   569 LMLLTLGLDTMFATIETIVTSISDE--FPKYLRTH-KPVFTLGCC---ICFFIMGFPMITQGGIY 627
            |||.|||:|:.|.|:|.:|||:.|.  ||...:.: .......||   :||       ....|.|
  Fly   483 LMLFTLGIDSQFGTLEGVVTSLVDMKLFPNLPKEYIVGALCFSCCTISMCF-------ANGAGSY 540

Human   628 MFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFI 692
            :|||:|::|.::.|:|||:||.:.|||:||::||.:|||||.|.:||.:|..||.:::|..:..|
  Fly   541 IFQLMDSFAGNFPLLIIALFECLSISYIYGVRRFSDDIEMMTGSRPNFYWMFCWKYLSPCAMVTI 605

Human   693 LCFSFYQWEPMTYGS--------------YRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGR 743
            |..||||.  :|.||              ..:|:|.:|:.:.::..|::||||:.|:::.     
  Fly   606 LLASFYQL--LTEGSSYPAWIGSKGATEGMEWPHWCIVVAFFLILSSILWIPIVAVLRLC----- 663

Human   744 FIERLKLVCSPQPDWGP 760
               .:|:|....|.|.|
  Fly   664 ---GIKVVEDSDPAWFP 677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A5NP_004202.3 SLC6sbd_GlyT2 191..787 CDD:271389 240/618 (39%)
CG10804NP_001138150.1 SLC6sbd-B0AT-like 120..661 CDD:271364 234/590 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.