DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCNB2 and CycA

Sequence 1:NP_004692.1 Gene:CCNB2 HGNCID:1580 Length:398 Species:Homo sapiens
Sequence 2:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster

Alignment Length:372 Identity:106/373 (28%)
Similarity:184/373 (49%) Gaps:33/373 (9%)


Human    14 ENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASV 78
            :|.||.|....||..::    :::..:.|...|.|  |:..:..:...|...|:|...:....|:
  Fly   104 DNNDTQVAPSGKSLASL----VDKENHDVKFGAGQ--KELVDYDLDSTPMSVTDVQSPMSVDRSI 162

Human    79 KPV-QMEKLA---PKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIY 139
            ..| |...::   ..|.|||.....:...|..|.|.:.:                   .|..||.
  Fly   163 LGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVV-------------------QYQMDIL 208

Human   140 QYLRQLEVLQSINPHFL-DGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPV 203
            :|.|:.|......|.:: ..:||:..||:||:||||:|..:::|..||||:.|..:||||....|
  Fly   209 EYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAV 273

Human   204 SRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLH 268
            .|.||||||..|:.:|:||||::.|.:.:||::||::||.:|:..||.:|||.|.|:|..|....
  Fly   274 VRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYV 338

Human   269 FLRRASKAGEVDVEQHTLAKYLMELTLIDYD-MVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYY 332
            |:...:...::..:...:..|:.||:|::.: .:.|.||.:::|:..|::.:||...|..:.:..
  Fly   339 FINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEI 403

Human   333 TGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMI 379
            |.|...::..|:.|:........|..|:  |::.||......|::|:
  Fly   404 TTYKLEDLKTVVLHLCHTHKTAKELNTQ--AMREKYNRDTYKKVAMM 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCNB2NP_004692.1 Cyclin_N 137..262 CDD:278560 57/126 (45%)
Cyclin_C 264..382 CDD:281044 25/118 (21%)
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 57/126 (45%)
Cyclin_C 334..450 CDD:281044 25/118 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.