DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LATS1 and wts

Sequence 1:XP_016866963.1 Gene:LATS1 HGNCID:6514 Length:1163 Species:Homo sapiens
Sequence 2:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster

Alignment Length:1114 Identity:469/1115 (42%)
Similarity:558/1115 (50%) Gaps:337/1115 (30%)


Human   177 SWKGSKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQAHPSNGQRVNPPPPPQ 241
            |..||..|..|..|          |:..|:|:| ||.|....|.|               |.|..
  Fly   151 SGAGSSRSDSPHSH----------HTHQPSSRT-VGNPGGNGGFS---------------PSPSG 189

Human   242 VRSVTPP-PPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPL 305
            ...|.|| ||||..|.....|.|||.  .|.||.        ||..|              .|.|
  Fly   190 FSEVAPPAPPPRNPTACSAATPPPPV--PPTSQA--------YVKRR--------------SPAL 230

Human   306 NTSP--MNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNGTGQ-TDFMIHQNVVPAGT 367
            |..|  :.||.|.         |..|:|.|:           |::|...| |..:...|:.|.|.
  Fly   231 NNRPPAIAPPTQR---------GNSPVITQN-----------GLKNPQQQLTQQLKSLNLYPGGG 275

Human   368 VNR--QPPPPYPLT-AANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNMELYNISVPGL 429
            ...  :|||||.:. .|.|.:|       ...|.|||  :..||...|.                
  Fly   276 SGAVVEPPPPYLIQGGAGGAAP-------PPPPPSYT--ASMQSRQSPT---------------- 315

Human   430 QTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQPSATTVT-AITPAP 493
                 ||..:..:.|||||                         .:||.|..|.:.:| ::.|||
  Fly   316 -----QSQQSDYRKSPSSG-------------------------IYSATSAGSPSPITVSLPPAP 350

Human   494 I------------QQP-----VKSMRVLKPELQTALAPTHPSWIP---QPIQTV-QPSPFPEGTA 537
            :            |||     |||.:|.||.||||:||..||...   .|:..: .|..:|:.:|
  Fly   351 LAKPQPRVYQARSQQPIIMQSVKSTQVQKPVLQTAVAPQSPSSASASNSPVHVLAAPPSYPQKSA 415

Human   538 SNVTVM------------------PPVAEAPNYQG--------PPPPYPK--------------- 561
            :.|...                  ||....|...|        .||.|.|               
  Fly   416 AVVQQQQQAAAAAHQQQHQHQQSKPPTPTTPPLVGLNSKPNCLEPPSYAKSMQAKAATVVQQQQQ 480

Human   562 -----------------------------------------------------HLLHQNPS---- 569
                                                                 .|.:.||.    
  Fly   481 QQQQQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQKLANGNPGRQML 545

Human   570 -VPPYESISKPSKEDQPSLPKEDESEKSYENV---------------------DSGDKEKKQITT 612
             .|||:|.:..:.|.:|.....:..:.|..|:                     .||.......||
  Fly   546 PPPPYQSNNNNNSEIKPPSCNNNNIQISNSNLATTPPIPPAKYNNNSSNTGANSSGGSNGSTGTT 610

Human   613 -------------SPITVRK---NKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRK 661
                         |||..||   .:|:|||:|.||:.|||||||||||||:|||:||::||.:||
  Fly   611 ASSSTSCKKIKHASPIPERKKISKEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYRK 675

Human   662 KQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCLARKVD 726
            .|||.||.:|||....|.:|||||.|||||||||||||||||||||:|.:|:||||||.|..|:|
  Fly   676 NQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKID 740

Human   727 T-KALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDM 790
            | ..|||.|||||.|||.|||||||||||||||||||.|||:||||||||||||||||||||||:
  Fly   741 TSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDL 805

Human   791 MSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRW 855
            |||||::|||.|.||||||||:||||:||||||||||||||||||||||||||||||||||||||
  Fly   806 MSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRW 870

Human   856 THDSKYYQ-SGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAP 919
            ||:||||| :|:|.|||||:...|:.:.     |.:...||||..|.|||.||||||||||||||
  Fly   871 THNSKYYQENGNHSRQDSMEPWEEYSEN-----GPKPTVLERRRMRDHQRVLAHSLVGTPNYIAP 930

Human   920 EVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKPGMVAHTCNPSALEGHSRKNTGT 984
            |||.|:|||||||:|||||||:|||||||||||.:|||||.|                       
  Fly   931 EVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQK----------------------- 972

Human   985 QEFEIGLGNIVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFS 1049
                      ||||:.:|||||||:||.||:|||.:||...:.||||: .||:|:|.|||.||| 
  Fly   973 ----------VINWEKTLHIPPQAELSREATDLIRRLCASADKRLGKS-VDEVKSHDFFKGIDF- 1025

Human  1050 SDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFR 1114
            :|:|:|.|.|||:|.|||||||||||||:||.|:|:...:.:|.     .......|.|:|||||
  Fly  1026 ADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGDDV-----DQNDRTFHGFFEFTFR 1085

Human  1115 RFFDDNGYP 1123
            |||||...|
  Fly  1086 RFFDDKQPP 1094

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LATS1XP_016866963.1 UBA_LATS1 103..143 CDD:270580
FtsK <448..>596 CDD:332908 48/269 (18%)
PKc_like 703..1117 CDD:328722 273/416 (66%)
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 265/406 (65%)
S_TKc 719..1020 CDD:214567 231/340 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C340278167
eggNOG 1 0.900 E1_KOG0608
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 699 1.000 Inparanoid score I664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoFinder 1 1.000 FOG0002438
OrthoInspector 1 1.000 T1073702
orthoMCL 1 0.900 OOG5_126822
Panther 1 1.100 O PTHR24356
Phylome 1 0.910 0.917 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4821
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.