DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDKL2 and PKD

DIOPT Version :9

Sequence 1:NP_001317653.1 Gene:CDKL2 / 8999 HGNCID:1782 Length:570 Species:Homo sapiens
Sequence 2:NP_001262705.1 Gene:PKD / 42203 FlyBaseID:FBgn0038603 Length:906 Species:Drosophila melanogaster


Alignment Length:435 Identity:105/435 - (24%)
Similarity:174/435 - (40%) Gaps:121/435 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     2 EKYENLG---------LVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKM---VKKIAM--REI 52
            |:.:::|         ::|.|.:|:|....:|.|.|.||||..     ||:   .|:.|.  .|:
  Fly   532 EQVQDMGQLYQIFPDEVLGSGQFGVVYGGVHKKTQREVAIKVI-----DKLRFPTKQEAQLKNEV 591

Human    53 KLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLELFPNGLDYQVVQKYLF-QIINGIGF 116
            .:|:.:.|..:|||..:.:..:|.::|.|.:...:|:.:.....|...:.|.|:|. ||:..:.:
  Fly   592 AILQNISHCGVVNLERMFETPERIFVVMEKLKGDMLEMILSHARGRLSERVTKFLITQILIALKY 656

Human   117 CHSHNIIHRDIKPENILVSQSG---VVKLCDFGFARTLAAPGE--VYTDYVATRWYRAPELLVGD 176
            .||.||:|.|:||||:|:|...   .|||||||:||.:   ||  .....|.|..|.|||:| .:
  Fly   657 LHSQNIVHCDLKPENVLLSSDAEFPQVKLCDFGYARII---GEKSFRRSVVGTPAYLAPEVL-RN 717

Human   177 VKYGKAVDVWAIGCLVTEMFMGEPLFPGDSDI-DQLYHIMMCLGNLIPRHQELFNKNPVFAGVRL 240
            ..|.:::|:|::|.::.....|...|..:.|| ||:.:...           ::..||       
  Fly   718 KGYNRSLDMWSVGVIIYVSLSGTFPFNEEEDINDQIQNAAF-----------MYPPNP------- 764

Human   241 PEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQ 305
                        :.::|...|||....|.:...||....:.|.|.:.|            ..:..
  Fly   765 ------------WKEISSNAIDLINNLLQVKQRKRYTVDKSLLHYWLQ------------DKQTY 805

Human   306 KDARNVSLSKKSQNRKKEKEKDD----------------SLVEERKTLVVQDTNADPKIKDYKLF 354
            :|.||:. ::....|....|.||                :::|....|:  ..:|:...:.|   
  Fly   806 RDLRNLE-AQVGAGRYLTHEADDLRWDCAGDMXPGCEPEAILESTTELI--SCSANTTTESY--- 864

Human   355 KIKGSKIDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSN 399
                            |.|.|.|....|           |.||.|
  Fly   865 ----------------RRSPADCAGCHR-----------LSDCGN 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDKL2NP_001317653.1 STKc_CDKL2_3 2..287 CDD:270836 84/305 (28%)
S_TKc 4..287 CDD:214567 83/303 (27%)
[NKR]KIAxRE 45..51 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..384 5/20 (25%)
PKDNP_001262705.1 C1_1 109..154 CDD:278556
C1 223..272 CDD:197519
PH_PKD 396..522 CDD:269945
STKc_PKD 539..798 CDD:270984 82/297 (28%)
S_TKc 547..799 CDD:214567 82/290 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.