DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDKL2 and Takl1

DIOPT Version :9

Sequence 1:NP_001317653.1 Gene:CDKL2 / 8999 HGNCID:1782 Length:570 Species:Homo sapiens
Sequence 2:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster


Alignment Length:422 Identity:99/422 - (23%)
Similarity:172/422 - (40%) Gaps:108/422 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     2 EKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNL 66
            ||:     :|.||.|.|.|...::....|.|..|||    :.:||.|.|||..|.::.|||::.:
  Fly    14 EKF-----LGAGSGGAVRKATFQNQEIAVKIFDFLE----ETIKKNAEREITHLSEIDHENVIRV 69

Human    67 LEVCKKKKRWYLVFEFVDHTILDDLELFPNGLDYQVVQ--KYLFQIINGIGFCHS--HNIIHRDI 127
            :......|:.||:.|:::...|.:.....:..:|.|.|  ::..|....:.:.||  ..|:||||
  Fly    70 IGRASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCAKALAYLHSLDRPIVHRDI 134

Human   128 KPENILV-SQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCL 191
            ||:|:|: :|...:|:||||.|..::   ...||...|..|.||| .:..:||....||::.|.:
  Fly   135 KPQNMLLYNQHEDLKICDFGLATDMS---NNKTDMQGTLRYMAPE-AIKHLKYTAKCDVYSFGIM 195

Human   192 VTEMFMGEPLFPGDSDIDQLYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKL 256
            :.|:...:                      :| :..|.|.|..:|.::.....|:.|:|......
  Fly   196 LWELMTRQ----------------------LP-YSHLENPNSQYAIMKAISSGEKLPMEAVRSDC 237

Human   257 SEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRK 321
            .|.:..|.:.|:.|:|:|||...|:            |:|..|                     :
  Fly   238 PEGIKQLMECCMDINPEKRPSMKEI------------EKFLGE---------------------Q 269

Human   322 KEKEKDDSLVE--ERKTLVVQDTNAD----------------PKIK-DYKLFKIKGSKI------ 361
            .|...|:..::  :..|:.|...:.|                |.|: .:.:.|.:..::      
  Fly   270 YESGTDEDFIKPLDEDTVAVVTYHVDSSGSRIMRVDFWRHQLPSIRMTFPIVKREAERLGKTVVR 334

Human   362 -------DGEKAEKGNRASNASCLHDSRTSHN 386
                   ||::..:  ||...:....||.:||
  Fly   335 EMAKAAADGDREVR--RAEKDTERETSRAAHN 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDKL2NP_001317653.1 STKc_CDKL2_3 2..287 CDD:270836 80/289 (28%)
S_TKc 4..287 CDD:214567 78/287 (27%)
[NKR]KIAxRE 45..51 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..384 5/20 (25%)
Takl1NP_732554.1 S_TKc 15..262 CDD:214567 78/282 (28%)
STKc_TAK1 17..274 CDD:270960 82/320 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.