DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCNB1 and CycA

Sequence 1:NP_114172.1 Gene:CCNB1 HGNCID:1579 Length:433 Species:Homo sapiens
Sequence 2:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster

Alignment Length:473 Identity:129/474 (27%)
Similarity:207/474 (44%) Gaps:105/474 (22%)


Human    12 NAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVI- 75
            |.||      .|.| :|.....|.:|       |..||.|..         |....|.|...|: 
  Fly    12 NKEN------PGIK-IPAGVKNTKQP-------LAVIGGKAE---------KNALAPRANFAVLN 53

Human    76 -DKKLPKPLEKVPM---------------------LVPV-------PVSEPVPEPEPEP------ 105
             :..:|:|..||.:                     :|||       .|.|...:.:..|      
  Fly    54 GNNNVPRPAGKVQVFRDVRNLNVDENVEYGAKKSNVVPVVEQFKTFSVYEDNNDTQVAPSGKSLA 118

Human   106 -----EPEPVK---------EEKLSPEPILV-DTASPSPMETSGCAPAEEDLCQAFSDVILAVND 155
                 |...||         :..|...|:.| |..||..::.|.....:.      ||:     .
  Fly   119 SLVDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQS------SDI-----S 172

Human   156 VDAEDGADPN----------------LCSEYVKDIYAYLRQLEEEQAVRPKYL-LGREVTGNMRA 203
            |..|.|..|.                ...:|..||..|.|:.|::...:|.|: ..::::.|||:
  Fly   173 VGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRS 237

Human   204 ILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGD 268
            |||||||:|..:::|..||:|::|..:|||:....|.:..|||||..||:||:||||:||||:|:
  Fly   238 ILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGE 302

Human   269 FAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLD 333
            |.|:||::|||.|:.:||..||:.|:|.|..|....|:...:.:.::..:...:..|:.||::::
  Fly   303 FVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLME 367

Human   334 YD-MVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKH 397
            .: .:.:.||.:::.:..||..||....|||.|:...:|..|.|..|:.||........:..|:.
  Fly   368 GETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQA 432

Human   398 MTVKNKYATSKHAKISTL 415
            |  :.||....:.|::.:
  Fly   433 M--REKYNRDTYKKVAMM 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCNB1NP_114172.1 Interaction with CDK2 169..177 3/8 (38%)
Cyclin_N 173..298 CDD:278560 60/126 (48%)
Interaction with CDK2 258..261 3/3 (100%)
Cyclin_C 300..418 CDD:281044 26/118 (22%)
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 60/126 (48%)
Cyclin_C 334..450 CDD:281044 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96075200
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.