DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCNA2 and CycA

Sequence 1:NP_001228.2 Gene:CCNA2 HGNCID:1578 Length:432 Species:Homo sapiens
Sequence 2:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster

Alignment Length:424 Identity:163/425 (38%)
Similarity:239/425 (56%) Gaps:59/425 (14%)


Human    47 RAALAVLKSGN----PRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKAN-----SKQPAFTIH 102
            ||..|||...|    |.|..|..|       .:::|.| ||:|.....|:|     .:...|:::
  Fly    46 RANFAVLNGNNNVPRPAGKVQVFR-------DVRNLNV-DENVEYGAKKSNVVPVVEQFKTFSVY 102

Human   103 VDEAEKE-AQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGS------FESPHTMDM 160
            .|..:.: |....:.:..:::|     |..:.....:|.||  ||.:|.:      .:||.::|.
  Fly   103 EDNNDTQVAPSGKSLASLVDKE-----NHDVKFGAGQKELV--DYDLDSTPMSVTDVQSPMSVDR 160

Human   161 SII---------LEDEKPVS----VNEVP------------DYHEDIHTYLREMEVKCKPKVGYM 200
            ||:         :..|..||    |.|:|            .|..||..|.||.|.|.:||..||
  Fly   161 SILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYM 225

Human   201 KKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLAS 265
            ::|.||:::||:||:||||||.|||||..|||:|:|.|:|||||.|:|:|.||||||||||.:|:
  Fly   226 RRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAA 290

Human   266 KFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQY-FLHQQPANCKV 329
            |:||||||||.|||::|||:|||.||||||.::||:|:|||..||...|:..| .|...|.  |:
  Fly   291 KYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPE--KL 353

Human   330 ESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDL 394
            :.:.:::.||||::.:.||:||||:::.|:..||.:.:..:.|...|...|.|.||.||..::.|
  Fly   354 KYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHL 418

Human   395 HQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPE 428
            ..|:..|.:...|::||||....|..|:::...|
  Fly   419 CHTHKTAKELNTQAMREKYNRDTYKKVAMMESVE 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCNA2NP_001228.2 Cyclin_N2 28..166 CDD:318660 33/144 (23%)
Cyclin_N 181..307 CDD:306612 84/126 (67%)
Cyclin_C 309..427 CDD:308564 38/119 (32%)
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 84/126 (67%)
Cyclin_C 334..450 CDD:281044 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 1 1.000
Homologene 1 1.000 H55562
Inparanoid 1 1.050 248 1.000 Inparanoid score I3202
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 1 1.000 T608785
orthoMCL 1 0.900 OOG5_126649
Panther 1 1.100 LDO PTHR10177
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4504
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.