DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SYNJ1 and Synj

Sequence 1:NP_003886.3 Gene:SYNJ1 HGNCID:11503 Length:1612 Species:Homo sapiens
Sequence 2:NP_001246454.1 Gene:Synj FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster

Alignment Length:1349 Identity:627/1350 (46%)
Similarity:832/1350 (62%) Gaps:179/1350 (13%)


Human    40 MAFSKGFRIYHK-LDPPPFSLIVETRHKEECLMFESGAVAVLSSAEKEAIKGTYSKVLDAYGLLG 103
            ||.||..|:..| :.|.|.|:::|.|:|.:.::|||.|||:|:..|.:.|:..|:||.||||.||
  Fly     1 MAMSKVIRVLEKSIAPSPHSVLLEHRNKSDSILFESHAVALLTQQETDVIRKQYTKVCDAYGCLG 65

Human   104 VLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFY 168
            .|:||.|::.:.:|||||||:|:|||.:.|:||:|.|.|:||:..:.:||:||||||:||||.||
  Fly    66 ALQLNAGESTVLFLVLVTGCVSMGKIGDIEIFRITQTTFVSLQNAAPNEDKISEVRKLLNSGTFY 130

Human   169 FAW-----SASGIS---LDLSLNAHRSMQEQTTDNRFFWNQSLHLHLKHYGVNCDDWLLRLMCGG 225
            ||.     ||||.|   .|::|.|.|..|.|.||||||||:.:|:||..:|::|..|||:.|||.
  Fly   131 FAHTNASASASGASSYRFDITLCAQRRQQTQETDNRFFWNRMMHIHLMRFGIDCQSWLLQAMCGS 195

Human   226 VEIRTIYAAHKQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVVYLDDSVSSFIQIRG 290
            ||:||:|...|||:|.:||||||||||||||||||||:|:||||||||||:|:|..|:|::|.||
  Fly   196 VEVRTVYIGAKQARAAIISRLSCERAGTRFNVRGTNDEGYVANFVETEQVIYVDGDVTSYVQTRG 260

Human   291 SVPLFWEQPGLQVGSHRVRMSRGFEANAPAFDRHFRTLKNLYGKQIIVNLL-----GSKEGEHML 350
            ||||||||||:|||||:|::|||||.:|.|||||...::..||.|.:||||     ||||||.||
  Fly   261 SVPLFWEQPGVQVGSHKVKLSRGFETSAAAFDRHMSMMRQRYGYQTVVNLLGSSLVGSKEGEAML 325

Human   351 SKAFQSHLKASEHAADIQMVNFDYHQMVKGGKAEKLHSVLKPQVQKFLDYGFFYFNGSEVQRCQS 415
            |..||.|...|.| .|:..|.|||||..:||....|..:.:..|....:||.|:.:..:|.|.|.
  Fly   326 SNEFQRHHGMSAH-KDVPHVVFDYHQECRGGNFSALAKLKERIVACGANYGVFHASNGQVLREQF 389

Human   416 GTVRTNCLDCLDRTNSVQAFLGLEMLAKQLEALGLAEKPQLVTRFQEVFRSMWSVNGDSISKIYA 480
            |.|||||||||||||.||.:|||:.|..|||||.:..|.|.::||:|:||.||..||:.:|||||
  Fly   390 GVVRTNCLDCLDRTNCVQTYLGLDTLGIQLEALKMGGKQQNISRFEEIFRQMWINNGNEVSKIYA 454

Human   481 GTGALEGKAKLKDGARSVTRTIQNNFFDSSKQEAIDVLLLGNTLNSDLADKARALLTTGSLRVSE 545
            ||||::|.:||.|||||..||||||..|:||||||||||:|:||:|:|||:||.||.:..|.   
  Fly   455 GTGAIQGGSKLMDGARSAARTIQNNLLDNSKQEAIDVLLVGSTLSSELADRARILLPSNMLH--- 516

Human   546 QTLQSASSKVLKSMCENFYKYSKPKKIRVCVGTWNVNGGKQFRSIAFKNQTLTDWLLDAPKLAGI 610
                 |.:.||:.:|:.:.:|.:|:..||.|||:||||||.||||.||: :|.|||||...||..
  Fly   517 -----APTTVLRELCKRYTEYVRPRMARVAVGTYNVNGGKHFRSIVFKD-SLADWLLDCHALARS 575

Human   611 QEFQDKRS------KPTDIFAIGFEEMVELNAGNIVSASTTNQKLWAVELQKTISRDNKYVLLAS 669
            :...|..:      .|.||:||||||:|:|||.||::|||.|.||||.||||||||||.||||..
  Fly   576 KALVDVNNPSENVDHPVDIYAIGFEEIVDLNASNIMAASTDNAKLWAEELQKTISRDNDYVLLTY 640

Human   670 EQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQS 734
            :|||||||:::|||:|||.|||||:|.||||:|||||||||.|||.:.|.||:||||:|||||||
  Fly   641 QQLVGVCLYIYIRPEHAPHIRDVAIDCVKTGLGGATGNKGACAIRFVLHGTSMCFVCAHFAAGQS 705

Human   735 QVKERNEDFIEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAGDQL 799
            ||.|||.|:.||.|||:|||||.|.|||:||||||||||||:..:|:||.:|..:..:::..|||
  Fly   706 QVAERNADYAEITRKLAFPMGRTLKSHDWVFWCGDFNYRIDMEKDELKECVRNGDLSTVLEFDQL 770

Human   800 INQKNAGQVFRGFLEGKVTFAPTYKYDLFSDDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLD 864
            ..::.||.||..||||::||.|||||||||||||||||.|.|||||||||||||          .
  Fly   771 RKEQEAGNVFGEFLEGEITFDPTYKYDLFSDDYDTSEKQRAPAWTDRVLWRRRK----------A 825

Human   865 LLNASFQDESKILYTWTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQNIYKEVIAVQG 929
            |....|...:     |.||.|:||||:|||.||||||:|:||.:|.|::.:.|:.::::||...|
  Fly   826 LAEGDFAASA-----WNPGKLIHYGRSELKQSDHRPVIAIIDAEIMEIDQQRRRAVFEQVIRDLG 885

Human   930 PPDGTVLVSIKSSLPENN-----FFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALN 989
            |||.|::|.:..|....:     .:|:.::..|:.:.:..|||.|:|:|||.|||||.:|.||||
  Fly   886 PPDSTIVVHVLESSATGDEDGPTIYDENVMSALITELSKMGEVTLVRYVEDTMWVTFRDGESALN 950

Human   990 VLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDV 1054
            ..|....::....:.:.|||.||...::.|:.|         .|::|:                 
  Fly   951 ASSKKSIQVCGLDLILELKSKDWQHLVDSEIEL---------CTTNTI----------------- 989

Human  1055 DDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPS 1119
                                      |..:   :|.:...:.:...|.||.||.:.|:|.|..|.
  Fly   990 --------------------------PLCA---NPVEHAQLLQAITPELPQRPKQPPTRPPARPP 1025

Human  1120 AQSSPIDAQPATP-------LPQKDPAQPLEPKRPPPPRPVAPPTRPAP--PQRPPPPSGARSPA 1175
            ...||.::....|       :|:  ||:|     |.||:|.:.|..|:|  ||..||...|....
  Fly  1026 MPMSPKNSPRHLPHVGVISIVPK--PAKP-----PMPPQPQSQPLIPSPLQPQVAPPRPPAMDTT 1083

Human  1176 PTRKEFGGIGAPPSPGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPPR 1240
            |:.|.       .||      .|...:..:|  .:.|::.|:..|.|:||         || |||
  Fly  1084 PSSKS-------QSP------TELVSASSST--SSSGKTSPTAPAVLSGP---------PT-PPR 1123

Human  1241 AGVISAPQSHARASAGRLTPESQSKTSETSKGSTFLPEPLKPQAAFPPQSSL------------- 1292
                   |..::.:....||..|..:.:         :|:....|:...|::             
  Fly  1124 -------QMQSKQATPVSTPTRQVGSPK---------DPIPSDTAYETASNIYEEIQEDVPAPRH 1172

Human  1293 PPPAQRLQEPLVPVAAPMPQSGPQPNLETPPQPPPRSRSSHSLPSEASS 1341
            ||||    .|...:.|||....|.||...||..|.||.::..||:..::
  Fly  1173 PPPA----GPPPVIGAPMGPPPPLPNRRGPPPIPNRSGNAPPLPTRPAN 1217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SYNJ1NP_003886.3 Syja_N 99..379 CDD:280532 175/293 (60%)
INPP5c_Synj1 572..907 CDD:197332 214/341 (63%)
DUF1866 906..1047 CDD:286093 43/146 (29%)
SynjNP_001246454.1 Syja_N 61..353 CDD:280532 175/293 (60%)
INPP5c_Synj 538..863 CDD:197323 214/341 (63%)
DUF1866 862..1008 CDD:286093 46/201 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C83884328
eggNOG 1 0.900 E1_COG5411
Hieranoid 1 1.000
Homologene 1 1.000 H48252
Inparanoid 1 1.050 1110 1.000 Inparanoid score I225
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D359616at2759
OrthoFinder 1 1.000 FOG0001373
OrthoInspector 1 1.000 T609138
orthoMCL 1 0.900 OOG5_128608
Panther 1 1.100 LDO PTHR11200
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1445
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.