DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IL18RAP and CG45263

Sequence 1:NP_003844.1 Gene:IL18RAP HGNCID:5989 Length:599 Species:Homo sapiens
Sequence 2:NP_731246.2 Gene:CG45263 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster

Alignment Length:367 Identity:74/368 (20%)
Similarity:119/368 (32%) Gaps:124/368 (34%)


Human    24 GCSTKKLLW-TYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSN---------- 77
            |..|||..| :....|:...||..||..|            |.|       :|.:          
  Fly    92 GIYTKKYEWASRMPTSDNGNVLHLDLHPP------------PVQ-------LGGDCSLWIRSATL 137

Human    78 DLSDVQWYQQPSNGD-PLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACCV 141
            |..|..|..|.:..| ..:|...|.|                                      |
  Fly   138 DFDDGLWECQVTASDFTTQDALTSQP--------------------------------------V 164

Human   142 KMILEVKPQTNASCEYSASH--KQDLLLGSTGSISCPSLSCQSDAQSPAVT--WYKNGKLLSVER 202
            ::::.|.|| ....||.|.|  ....:....|:::  ::.|.|...:|..|  |:...:      
  Fly   165 RLVVRVAPQ-RPRLEYEAVHVPPGHNITADAGALA--TVKCISHYGNPPATLKWFLGDQ------ 220

Human   203 SNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQVRTIVGDTKLKPDILD------------ 255
                   |:...|.   ..:.|:.|...:|:..:||||..:   .:...|||.            
  Fly   221 -------EISPIHP---QMNATEPDNPRTWSATSVVQVSAM---RERHGDILRCAAYHESYTAKS 272

Human   256 -PVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSD----LEW-EVSVPEAKSIKSTLKD 314
             .||..|:|:....:.:........|...:.::...:.|::    :.| .....|..|::.||: 
  Fly   273 VVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQ- 336

Human   315 EIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQ-SVQLKEK 355
                    |..|.:|| ...:.|..|||:|.:.| ||||..|
  Fly   337 --------LRPVGRRD-AGLYTCQAQNSVGTSEQLSVQLDVK 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IL18RAPNP_003844.1 Ig 160..>221 CDD:325142 9/65 (14%)
TIR 419..559 CDD:307630
CG45263NP_731246.2 I-set 53..149 CDD:254352 18/76 (24%)
Ig 198..281 CDD:299845 20/104 (19%)
IG_like 302..368 CDD:214653 20/76 (26%)
IGc2 302..357 CDD:197706 14/65 (22%)
Ig 372..446 CDD:299845
Ig 475..568 CDD:299845
IG_like 478..570 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.