DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IL18RAP and sns

Sequence 1:NP_003844.1 Gene:IL18RAP HGNCID:5989 Length:599 Species:Homo sapiens
Sequence 2:NP_001036532.1 Gene:sns FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster

Alignment Length:466 Identity:88/467 (19%)
Similarity:144/467 (31%) Gaps:194/467 (42%)


Human    41 EFVLFCDLPEPQKSHFCHRN----------------RLSPKQV-----PEHL-PFM--------- 74
            |..:..::.:.|..:.|..:                ..:|:.|     ||.| |.|         
  Fly   538 EITILANVSDNQAQYRCEASNSATEIPLFQSTTLSVHFAPETVKIRIEPEELRPGMEATIICDSS 602

Human    75 GSNDLSDVQWYQQPSNGDPLEDIRK-SYPHIIQDK-CTLHFLTPGVN-----NSGSYIC------ 126
            .||..:.:.|::   :|.|:|.|.. |.|.:.... .||.|   .||     |...|.|      
  Fly   603 SSNPPAKLSWWK---DGIPIEGINNTSKPGLWGGTVSTLEF---RVNVTQEMNGQVYTCQSANEA 661

Human   127 ---------------RPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCP 176
                           |||.:..|...|                            :|..|.....
  Fly   662 LQRSAHEAVSLDVLYRPKFVPPPSSTA----------------------------VGVEGESLQV 698

Human   177 SLSCQSDAQSPAVTWYKNGKLLSVERSNRIVVD-------EVYDYHQGTYVCDYTQSDTVSSWTV 234
            ||..:::.......|.|:|..:..:..:||..|       .::....|.|.|..:.|...::..:
  Fly   699 SLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNI 763

Human   235 RAVVQVRTIVGDTKLKPDILDPVEDTL---EVELGKPLTISCKARFGFERV-FNPVIK------- 288
            ..||:..|.:.... :..:::|.||.:   .|| |||||   :....:||| ::..:|       
  Fly   764 TVVVEYGTTIKSVS-ENIVVNPGEDAMLSCTVE-GKPLT---EEHVKWERVGYDMTVKTSTTFAN 823

Human   289 ----WYIKDSDLEWEVS------------------------VPE-AKS----------------- 307
                .:|||:..| :|.                        .|| ||:                 
  Fly   824 GTSYLHIKDAKRE-DVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLP 887

Human   308 ---------------------IKSTLKDEIIERNI---------ILEKVTQRDLRRKFVCFVQNS 342
                                 |..|.|.|:.||.|         |::||...|. ..:.|..:|.
  Fly   888 CRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADY-GAYECVARNE 951

Human   343 IGNTTQSVQLK 353
            :|...::|:|:
  Fly   952 LGEAVETVRLE 962

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IL18RAPNP_003844.1 Ig 160..>221 CDD:325142 12/68 (18%)
TIR 419..559 CDD:307630
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653 3/35 (9%)
Ig 501..560 CDD:299845 3/22 (14%)
Ig 584..666 CDD:299845 22/88 (25%)
IG_like 585..666 CDD:214653 22/87 (25%)
I-set 678..767 CDD:254352 19/117 (16%)
IGc2 692..757 CDD:197706 13/65 (20%)
Ig 788..849 CDD:143165 16/66 (24%)
Ig 885..960 CDD:143165 15/76 (20%)
FN3 967..1051 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.