DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IL18RAP and Dscam2

Sequence 1:NP_003844.1 Gene:IL18RAP HGNCID:5989 Length:599 Species:Homo sapiens
Sequence 2:NP_001261500.1 Gene:Dscam2 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster

Alignment Length:507 Identity:96/508 (19%)
Similarity:161/508 (32%) Gaps:195/508 (38%)


Human    88 PSNGDPLEDIR-----KSYPHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACC------- 140
            |..|.|:|:|.     :..|..|:.:         |...||....|....|...|..|       
  Fly   542 PVAGYPIEEIHWERGGRELPDDIRQR---------VQPDGSLTISPVQKNSDSGVYTCWARNKQG 597

Human   141 --------VKMIL--EVKP-QTNASCEYSASHKQDLLLGSTGSISCPSLSCQSDAQSP-AVTWYK 193
                    |.:|:  ::.| |||.         ..|.:|...|::|..:.    ...| .:.|.|
  Fly   598 HSARRSGEVTVIVPPKLSPFQTNI---------LQLNMGDRASLTCSVVK----GDLPLTINWRK 649

Human   194 NGK---------LLSVERSNRI-VVDEVYDYHQGTYVCDYTQS--DTVSSWTVRAVVQVRTIVGD 246
            :|:         :..|::.|.| |::.:...|.|.|.|....|  :..:|..:...|..|.||  
  Fly   650 DGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIV-- 712

Human   247 TKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEVSVPEAKSIKST 311
                    :||:  ..||..:.:.:.|:|    :.|..|.|.|             .:|...||.
  Fly   713 --------EPVD--ANVERNRHIMLHCQA----QGVPTPSIVW-------------KKATGSKSG 750

Human   312 LKDEIIER---------NIILEKVTQRDLRRKFVCFVQNSIG------------------NTTQS 349
            ..:|:.||         :::|:.| :.|....::|...|.||                  :|::|
  Fly   751 EYEEVRERPFTKLLGNGSLLLQHV-KEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRS 814

Human   350 VQLKEKRGVVLLYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSY 414
            |.:|:           |....|...::....:...|:         :|...||....::..    
  Fly   815 VMVKK-----------GDTALLQCAVSGDKPINIVWM---------RSGKNTLNPSTNYKI---- 855

Human   415 AKWSSFPSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIF 479
                |...|||                                 |.||.||..:..:..:..|.:
  Fly   856 ----SVKQEAT---------------------------------PDGVSAELQIRTVDATDSGPY 883

Human   480 ILSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKAL 531
            ..              .|.||..:||.|..:.:     |||...|.:::.|:
  Fly   884 FC--------------RASNLYGNDQQLVQLQV-----QEPPLPPSVLEAAM 916

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IL18RAPNP_003844.1 Ig 160..>221 CDD:325142 15/72 (21%)
TIR 419..559 CDD:307630 21/114 (18%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352 16/77 (21%)
IGc2 533..597 CDD:197706 14/64 (22%)
Ig 630..699 CDD:143165 15/73 (21%)
IG_like 714..802 CDD:214653 23/108 (21%)
Ig 725..802 CDD:299845 19/95 (20%)
Ig 823..894 CDD:143165 18/135 (13%)
FN3 906..1006 CDD:238020 2/12 (17%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.