DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IL18RAP and CG13506

Sequence 1:NP_003844.1 Gene:IL18RAP HGNCID:5989 Length:599 Species:Homo sapiens
Sequence 2:NP_001286718.1 Gene:CG13506 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster

Alignment Length:432 Identity:85/433 (20%)
Similarity:147/433 (34%) Gaps:151/433 (35%)


Human    40 EEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQP---SNGDPLEDIRKSY 101
            ::.:|.||.          ||            |..||   .|.||:..   :||.  ..|.:..
  Fly    85 DDVILNCDA----------RN------------FQLSN---AVVWYKNRIIIANGQ--NPISQRV 122

Human   102 PHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLL 166
            ..::.:...|..::|  .:|..|.|                   |:.||...  :::|     |.
  Fly   123 QCMLNNSILLRNVSP--EDSDDYYC-------------------EILPQRVR--QHTA-----LR 159

Human   167 LGSTGSISCP-----------------SLSCQSDAQSPA-VTWY---KNGKLLSVERSNRIVV-D 209
            :|:..||.|.                 .|.|::.....| :.|.   .||:..||:..|.::: |
  Fly   160 VGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILD 224

Human   210 EVYDYHQGTYVCDYTQSDTVSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPLTISCK 274
            .|.:.:.|.|.|   .:|..|.......|.:     |.:..| |:......:..|.|....:.|.
  Fly   225 NVDEKNAGDYQC---LADDGSRHPPHGTVHI-----DVQYSP-IVSTHRHNVNTEKGATAELYCN 280

Human   275 ARFGFERVFNPVIK-WYIKDSDLEWEVSVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCF 338
            .|      ..|:.: ::|||..   .:.:.:..|:|.::.::.....:|:.:||..|| .:::|.
  Fly   281 YR------AKPIGRSYFIKDGK---TLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDL-GEYLCQ 335

Human   339 VQNSIGNTTQSVQLK-------------EKRGVVLLYILLGTIGTLVAVLAASALLYRHWIEIVL 390
            |:|:||:....|.:.             |...|.|                       ||     
  Fly   336 VENAIGSNEVKVHVSYNPETPQFEDMTVEGNKVTL-----------------------HW----- 372

Human   391 LYRTYQSKDQTLGDKKDFDAFVSYAKWSSFPSEATSSLSEEH 432
            |.|::|...:.:   .|:....||. ||      |..:.|.|
  Fly   373 LVRSHQLLSEAM---LDYQLTGSYT-WS------TVQVLETH 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IL18RAPNP_003844.1 Ig 160..>221 CDD:325142 18/83 (22%)
TIR 419..559 CDD:307630 3/15 (20%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 19/109 (17%)
IGc2 83..146 CDD:197706 19/109 (17%)
IG_like 176..254 CDD:214653 18/86 (21%)
Ig 176..239 CDD:299845 14/66 (21%)
I-set 258..349 CDD:254352 23/102 (23%)
Ig 275..348 CDD:143165 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.