DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IL18RAP and otk

Sequence 1:NP_003844.1 Gene:IL18RAP HGNCID:5989 Length:599 Species:Homo sapiens
Sequence 2:NP_523705.2 Gene:otk FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster

Alignment Length:357 Identity:71/358 (20%)
Similarity:130/358 (36%) Gaps:82/358 (23%)


Human   110 TLHFLTPGVNNSGSYICRPKM-----IKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGS 169
            ||.|.:...:::|.|.|:.::     |.|...:...::.:..|...|:.:.|..|         .
  Fly   338 TLSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVPQPTSKNLELDA---------V 393

Human   170 TGSISCPSLSCQSDAQSPAVTWYKNGK------LLSVERSNRIVVDEVYDYHQGTYVCDYTQSDT 228
            ...:.|.:    ....:|.|.|.::|:      .:.|:.:..::...|...|:|.|.|..|.   
  Fly   394 VAKVHCKA----QGTPTPQVQWVRDGENTTLPDHVEVDANGTLIFRNVNSEHRGNYTCLATN--- 451

Human   229 VSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKD 293
             |...:.|.|.:..:| ..|.....:.|:|.:   |.| .:.:.|:| .|..:   |.|:|   |
  Fly   452 -SQGQINATVAINVVV-TPKFSVPPVGPIETS---EQG-TVVMHCQA-IGDPK---PTIQW---D 503

Human   294 SDLEWEVSVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQL------ 352
            .||::   :.|..:.:...:  .:|...:..:..|.:....:.|.:.||.|...:.|||      
  Fly   504 KDLKY---LSENNTDRERFR--FLENGTLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVKTTG 563

Human   353 -----KEKRG----VVLLYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSK--------DQ 400
                 :|..|    |....::..|:.....||....:|   |..    ||....|        .:
  Fly   564 DGFAPEESGGDGFLVTRAVLITMTVALAYIVLVVGLML---WCR----YRRQARKARLNDLSTKE 621

Human   401 TLGDKKDFDAFVSYAKWSSFPSEATSSLSEEH 432
            ..||:.|       ...:...||....||::|
  Fly   622 AGGDQPD-------VAGNGKGSEQEPCLSKQH 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IL18RAPNP_003844.1 Ig 160..>221 CDD:325142 10/67 (15%)
TIR 419..559 CDD:307630 5/15 (33%)
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845 8/35 (23%)
Ig 395..460 CDD:143165 14/73 (19%)
I-set 468..559 CDD:254352 24/107 (22%)
IGc2 484..549 CDD:197706 16/78 (21%)
PTK_CCK4 686..1026 CDD:133178
STYKc 692..1020 CDD:214568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.