DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IL18RAP and Toll-4

Sequence 1:NP_003844.1 Gene:IL18RAP HGNCID:5989 Length:599 Species:Homo sapiens
Sequence 2:NP_523519.2 Gene:Toll-4 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster

Alignment Length:640 Identity:130/641 (20%)
Similarity:232/641 (36%) Gaps:180/641 (28%)


Human    14 GERIKGFNISGCSTKKL-------LWTYSTRSEEEFVLFCDLPEPQKSHFCH-----------RN 60
            |...|.||:      ||       :|.:|...:|..:...:.|.|.:...|.           ||
  Fly   557 GPSDKYFNL------KLMEALNHAIWLFSGEFDEIILHHLNSPCPYRCSCCFEWHTGEFLINCRN 615

Human    61 ---RLSPKQVPEHLP-----FMGSNDLSDVQWYQQPSNGDPL--------------EDIRKSYP- 102
               .:.|: :|..:|     ::..|::      ::.:|.:.|              :::.:..| 
  Fly   616 LSLDIYPR-LPNSIPYKTTLYLDRNEI------RKLTNTESLVVAGHASIHKLHMSQNLLRELPL 673

Human   103 HIIQDKCT--------LHFLTPGVNNSGSY---ICRPKMIKSPYDVACCVKMILEVKPQTNASCE 156
            |::.:..|        |.:|..||.....|   |.:.::..:|::..|..|..|... :.:...|
  Fly   674 HLLPENITYLDVRNNLLKYLDDGVIAFLEYRENITKIELSGNPWECNCKAKAFLSFL-RRHEPME 737

Human   157 YSASHKQDLLLGSTGSISCPS--LSCQSDAQSPAVTWYK--NGKLLSVERSNRIVVDEVYDYHQG 217
            |....::..:...    .||.  :.|...:.|.::.:..  :||.||     .|.......|.|.
  Fly   738 YETVLRRVEITDD----KCPEDCICCVDTSNSDSLAYVVDCSGKELS-----EIPQLPTPTYGQT 793

Human   218 TYVCDYTQSDTVSSW---------TVRAVVQVRTIVGDTKLKPDILD----------PVEDTLEV 263
            |.|   .:.:::..|         :|.........:.|....||.|:          .::|.:..
  Fly   794 TLV---FERNSLKKWPSSLLPGYSSVTRFYLAHNRLSDIDQLPDKLEYLDISNNNFSALDDRVRG 855

Human   264 ELGKPLTIS--CKARFGFERVFNPVIKWYIKDSDLEWEVSVPE-AKSIKSTLKDEIIERNIILEK 325
            .|.|.:..|  ..:.||     ||   |..:..|.::.|.|.| ||:|.:....:.|:....|.:
  Fly   856 FLQKRMNSSQLQLSLFG-----NP---WTCRCEDKDFLVFVKEQAKNIANASAIQCIDTGRSLIE 912

Human   326 VTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVLLYILLGTIGTLVAVLAASALL--------- 381
            |.:.|     :|                   ..||:|.....:..|:..|:.:..:         
  Fly   913 VEETD-----IC-------------------PSVLIYYTSLAVSLLIIALSINVFICFRQPIMIW 953

Human   382 -YRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSFPSEATSSLSEEHLALSLFPDVLEN- 444
             |.|.|.:.|..|      :.|.:.|.:|||:|:       :.....|.||      |.|.||| 
  Fly   954 FYEHEICLSLAAR------RELDEDKKYDAFLSF-------THKDEDLIEE------FVDRLENG 999

Human   445 KYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFILSPNYVNGP-SIFELQAAVNLALDDQTLK 508
            ::.:.||...||...|....:.|...:|.|||.|.:::.|::... ...|.:.|::....|:..:
  Fly  1000 RHKFRLCFYLRDWLVGESIPDCINQSVKGSRRIIILMTKNFLKSTWGRLEFRLALHATSRDRCKR 1064

Human   509 LILIKFC---YFQEPESLPHLVKKALRVLPTVTWRGLKSVPPNSRFWAKMRYHMP 560
            ||::.:.   :|.:.:|    ..:|..||.|...|.      |..||.|:.|.||
  Fly  1065 LIVVLYPDVEHFDDLDS----ELRAYMVLNTYLDRN------NPNFWNKLMYSMP 1109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IL18RAPNP_003844.1 Ig 160..>221 CDD:325142 13/65 (20%)
TIR 419..559 CDD:307630 37/145 (26%)
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
leucine-rich repeat 388..408 CDD:275380
LRR_8 412..465 CDD:290566
leucine-rich repeat 412..432 CDD:275378
LRR_4 432..470 CDD:289563
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378
leucine-rich repeat 479..490 CDD:275378
leucine-rich repeat 632..657 CDD:275378 3/31 (10%)
leucine-rich repeat 658..679 CDD:275378 2/21 (10%)
leucine-rich repeat 680..706 CDD:275378 6/26 (23%)
leucine-rich repeat 707..719 CDD:275378 2/12 (17%)
leucine-rich repeat 771..791 CDD:275380 6/25 (24%)
leucine-rich repeat 793..815 CDD:275378 3/25 (12%)
leucine-rich repeat 816..835 CDD:275378 4/19 (21%)
leucine-rich repeat 836..859 CDD:275378 3/23 (13%)
TIR 974..1110 CDD:214587 43/160 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.