DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IL18RAP and Fas2

Sequence 1:NP_003844.1 Gene:IL18RAP HGNCID:5989 Length:599 Species:Homo sapiens
Sequence 2:NP_001284854.1 Gene:Fas2 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster

Alignment Length:496 Identity:103/497 (21%)
Similarity:181/497 (36%) Gaps:124/497 (25%)


Human    67 VPEHLPFMGSNDLSDVQWYQQPSNGD-PLEDIRKSYPHIIQ----DKCTLHFLTPGVNNSGSYIC 126
            |||  |.:    ::|:||....:|.. |..:.|...|...:    :...|...:..|...|.|.|
  Fly    58 VPE--PSL----VADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMGGKYYC 116

Human   127 RPKMIKSPYDVACCVKMILE--VKPQTNASCEY-SASHKQDLLLGSTGSISCPSLSCQSDAQSPA 188
            ......:.         |||  |..:|..:..: :|...|...||....:.|   ..::| .:|.
  Fly   117 TASYANTE---------ILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMC---EVKAD-PNPT 168

Human   189 VTWYKNGKLLS------VERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV-----RT 242
            :.|.:||..:.      |.::|.:::..|.:..:|.|.|.            .||::.     ||
  Fly   169 IDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCR------------AAVIETGELLERT 221

Human   243 IVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPV--IKWYIKDSDLEWEVSVPEA 305
            |..:..::|:|:. :...||...|||...:|.||      ..||  |.| |:|:.   :::|..|
  Fly   222 IRVEVFIQPEIIS-LPTNLEAVEGKPFAANCTAR------GKPVPEISW-IRDAT---QLNVATA 275

Human   306 KSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVL---LYILLGT 367
            ...:...:..:    :.:..|:|.|. ..:.|..:|..|...|    |.|..|::   :|.|...
  Fly   276 DRFQVNPQTGL----VTISSVSQDDY-GTYTCLAKNRAGVVDQ----KTKLNVLVRPQIYELYNV 331

Human   368 IGTLVAVLA---------ASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSFPSE 423
            .|.....:|         |.|:.:|.|         ...::.|.|.:.|....:....:.....|
  Fly   332 TGARTKEIAITCRAKGRPAPAITFRRW---------GTQEEYTNGQQDDDPRIILEPNFDEERGE 387

Human   424 ATSSL---SEEHLALSLFPDVLENK--YGYSLCLLERDVAPGGVYAEDIVSIIKRSRR------- 476
            :|.:|   :.|.....|:..:..||  ..|....:..:.||...:.:::..:....:|       
  Fly   388 STGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCL 452

Human   477 --GIFILSPN-----YVNGPSIFELQAAVNLALDDQTLKLI 510
              ||    ||     :.||..|.:|.        |..||::
  Fly   453 AMGI----PNATIEWHWNGRKIKDLY--------DTNLKIV 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IL18RAPNP_003844.1 Ig 160..>221 CDD:325142 14/67 (21%)
TIR 419..559 CDD:307630 22/112 (20%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 20/90 (22%)
IG_like 144..226 CDD:214653 20/98 (20%)
IGc2 152..209 CDD:197706 13/73 (18%)
I-set 230..319 CDD:254352 27/109 (25%)
IGc2 243..309 CDD:197706 19/81 (23%)
IG_like 330..424 CDD:214653 17/103 (17%)
IGc2 339..412 CDD:197706 14/82 (17%)
Ig 447..518 CDD:143165 11/48 (23%)
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.