DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42514 and Slc35a1

DIOPT Version :9

Sequence 1:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_006537954.1 Gene:Slc35a1 / 24060 MGIID:1345622 Length:376 Species:Mus musculus


Alignment Length:299 Identity:50/299 - (16%)
Similarity:102/299 - (34%) Gaps:103/299 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 AMLTNAWFLQWENISAHVFPIILALFLGSFSDRRGRKLPLLMGLVGKFFYSTMIVVNARMT--TW 174
            |:..|..||...|:.|.|:.:...|           |:|...       ..|::::|..::  .|
Mouse    99 AVQNNMAFLALSNLDAAVYQVTYQL-----------KIPCTA-------LCTVLMLNRTLSKLQW 145

  Fly   175 PVQNIIYSATLPSALTGADVAIFASCFAYISDISSLQQRTIRVTILDVIYLSAMP--MGVALGSH 237
                               :::|..|    ..::.:|.:..:.|.:......:||  ....:..|
Mouse   146 -------------------ISVFMLC----GGVTLVQWKPAQATKVVPTVPGSMPTVSDSDVSGH 187

  Fly   238 LFYNVFNQSYADMFTVNA-------------SLLALAIIYTLCALKWQTTPRQRSLRELGCCGFW 289
            :...:..|..|....|:|             ..:|:|::                     |.||.
Mouse   188 VLMRIGKQKAALYGKVSALTGKVAQNPLLGFGAIAIAVL---------------------CSGFA 231

  Fly   290 GDFFDKQHVKDSLAVLVKPRKGHRRSFLIILLVSMALYTFQRD-----EGQYLYMYTL------- 342
            |.:|:|.......::.|:    :.:.:|..::|::| .|:..|     |..:.|.||.       
Mouse   232 GVYFEKVLKSSDTSLWVR----NIQMYLSGIVVTLA-GTYLSDGAEIQEKGFFYGYTYYVWFVIF 291

  Fly   343 -----GKFDWDVSAYSN--FKTFKSSAYVIAMLLAVPLM 374
                 |.:...|..|::  .|.|.::|.::...:|..|:
Mouse   292 LASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVLL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 44/282 (16%)
MFS 132..495 CDD:119392 43/279 (15%)
Slc35a1XP_006537954.1 Nuc_sug_transp 8..354 CDD:282054 50/299 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.