DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42514 and Slc35a2

DIOPT Version :9

Sequence 1:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_511039.2 Gene:Slc35a2 / 22232 MGIID:1345297 Length:393 Species:Mus musculus


Alignment Length:417 Identity:98/417 - (23%)
Similarity:146/417 - (35%) Gaps:127/417 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VVEQNFFLYKSCRVNRNFTEEICRNLNKPENEEFRTKAMLTNAWFLQWENISAHVFPIILALFLG 139
            :|.||..|..|.|..|..          |.:..|.|.|:           :.|.|...:..|.| 
Mouse    43 LVVQNASLILSIRYARTL----------PGDRFFATTAV-----------VMAEVLKGLTCLLL- 85

  Fly   140 SFSDRRGRKLPLLMGLVGKFFYSTMIVVNARMTTWPVQNIIYSATLPSALTGADVAIFASCFAYI 204
            .|:.:||....|::     |.:..::|.........|.::||  ||.:.|            .|:
Mouse    86 LFAQKRGNVKHLVL-----FLHEAVLVQYVDTLKLAVPSLIY--TLQNNL------------QYV 131

  Fly   205 SDISSLQQRTIRVT----ILDVIYLSAMPMGVALGSHLFYNVFNQSYADMFTVNASLLAL----A 261
            : ||:|...|.:||    ||.....|.:.:..:| |.|.:              ||||.|    |
Mouse   132 A-ISNLPAATFQVTYQLKILTTALFSVLMLNRSL-SRLQW--------------ASLLLLFTGVA 180

  Fly   262 IIYTLCA-----LKWQTTPRQRSLRELGCC---GFWGDFFDKQHVKDSLAVLVKPRKGH---RRS 315
            |:....|     ......|.......:..|   ||.|.:|:|         ::|...|.   |..
Mouse   181 IVQAQQAGGSGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEK---------ILKGSSGSVWLRNL 236

  Fly   316 FLIILLVSMALYTFQRDEGQ------YLYMYTLGKFDWDVSAYSNFKTFKSSAYVIAMLLAVPLM 374
            .|.:...::.|......||.      :.:.||...  |.|.....|.         .:|:||.:.
Mouse   237 QLGLFGTALGLVGLWWAEGTAVASQGFFFGYTPAV--WGVVLNQAFG---------GLLVAVVVK 290

  Fly   375 ---NKILGWRDTTIIFIGTWAHSIARLFFYFATNTDLLYAGAVVCSLGPIVGPMIRAMTSKIVPT 436
               |.:.|:..:..|.:.|.| || |||.:   :.|.|:|      ||  .|.:|.|:....:| 
Mouse   291 YADNILKGFATSLSIVLSTVA-SI-RLFGF---HLDPLFA------LG--AGLVIGAVYLYSLP- 341

  Fly   437 SERGKVFALLSVCDNAVPFISGVCYSQ 463
              ||.|.|:.|..      .||.|..|
Mouse   342 --RGAVKAIASAS------ASGPCIHQ 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 82/356 (23%)
MFS 132..495 CDD:119392 85/360 (24%)
Slc35a2NP_511039.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Nuc_sug_transp 31..339 CDD:282054 88/385 (23%)
nst 114..338 CDD:129885 67/286 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.