DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42507 and PCL7

DIOPT Version :8

Sequence 1:NP_001163443.1 Gene:CG42507 / 8674092 FlyBaseID:FBgn0260233 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_012214.3 Gene:PCL7 / 854761 SGDID:S000001312 Length:285 Species:Saccharomyces cerevisiae

Alignment Length:117 Identity:27/118 (23%)
Similarity:45/118 (38%) Gaps:21/118 (18%)


  Fly    17 GGS------GQQQHN--TSSSSHNNSSNNCGTAAATQLSSSSNSRSI---TPATSTSSTGTGTGT 70
            ||:      |...|:  |...|.||||.....:....|.|..:|:|:   :|..:...:......
Yeast    19 GGNRDNLIIGPHSHSFKTDPFSSNNSSLLSKISTNPSLESPFSSKSLLDCSPVQAVKKSLESEAK 83

  Fly    71 TSTLQR--------RILRGHAAQTTSGERVLLINYVPQTGASATASTQSTSQ 114
            |.:|..        :||  :.|...:.|.:|:|:.:.....:|...|...||
Yeast    84 THSLDEETNEQTDVKIL--NIADFPTDELILMISALLNRIITANDETTDVSQ 133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42507NP_001163443.1 None
PCL7NP_012214.3 Cyclin 109..264 CDD:285777 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128496
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.