DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-12

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_505731.3 Gene:twk-12 / 192074 WormBaseID:WBGene00006667 Length:684 Species:Caenorhabditis elegans


Alignment Length:255 Identity:69/255 - (27%)
Similarity:100/255 - (39%) Gaps:77/255 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSK 664
            |.:..|..|:..:.||||||....:|..|||.|:.||.||||..|:||.|.|..|:         
 Worm   112 WTWTGAMFYAGQLYTTIGYGYPTTKTDEGRICTIFYALFGIPCFLMYLKSIGKTLS--------- 167

  Fly   665 ALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGA 729
                             |:|.:..:::||.|....|...:              .|..||   |.
 Worm   168 -----------------KKMKKYYKKLRRSRVGRILLPTR--------------VTAMKD---GF 198

  Fly   730 PPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLE-KWP 793
            ..|.|                 |.|.:....      ||.:...|:||:|.|.|::....| .|.
 Worm   199 EDPEA-----------------AEERKKKPF------PIPIAIIMLIIWICFSASMFCIWEDTWV 240

  Fly   794 ILDGIYFCFMSLSTIGFGDML---PGLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEEI 850
            ....:||..:|:||:|.||||   |.:       ..|..:.|:.|:.|.:|||.:|.:.:
 Worm   241 FSSAVYFFIVSISTVGLGDMLFRTPDM-------MVFNFLLILVGLALLSMCFELITDRV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 26/55 (47%)
Ion_trans <601..640 CDD:278921 16/38 (42%)
Ion_trans_2 774..846 CDD:285168 26/75 (35%)
twk-12NP_505731.3 Ion_trans_2 92..167 CDD:285168 25/54 (46%)
Ion_trans_2 226..>272 CDD:285168 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.