DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-26

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_508522.2 Gene:twk-26 / 180592 WormBaseID:WBGene00006679 Length:519 Species:Caenorhabditis elegans


Alignment Length:296 Identity:68/296 - (22%)
Similarity:105/296 - (35%) Gaps:119/296 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSK 664
            |.|:.|..||:|:.:|||||.::.:|..||.:::.||..|:|:.||.|...|        |.|.|
 Worm   185 WYFSSATFYSMTLFSTIGYGTISCQTVWGRTLSMIYASIGLPIMLVVLGDIG--------EWFQK 241

  Fly   665 ALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGA 729
            .|     :| ||.....|....:::.:.||:.:                                
 Worm   242 IL-----TN-GYIFLLLKYKKLRKQPVNRKKNE-------------------------------- 268

  Fly   730 PPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLE---- 790
                                              ||.|:.|...:::.||:.....:...:    
 Worm   269 ----------------------------------ILLPMWLALFLVLAYILICTLTIKMFDHNEG 299

  Fly   791 KWP---ILDGIYFCFMSLSTIGFGDMLP---------------GLRRESNATTWFCSVYIMSGMT 837
            ..|   ..|..||.|:||:|||.||::|               ||...|...|   |:|..    
 Worm   300 NKPGIGFFDAFYFTFISLTTIGLGDVMPYNIQYSPFLAAAFLLGLALISIVNT---SIYAQ---- 357

  Fly   838 LTAMCFNVIH--EEIVHRIRIVVEFKKTSAANSGGG 871
            |..|.||:|:  |:.:.||.        |:.:.|.|
 Worm   358 LYQMFFNMINSVEDQLDRIH--------SSNHKGPG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 22/55 (40%)
Ion_trans <601..640 CDD:278921 15/38 (39%)
Ion_trans_2 774..846 CDD:285168 25/93 (27%)
twk-26NP_508522.2 Ion_trans_2 <185..241 CDD:285168 24/63 (38%)
Ion_trans_2 278..>327 CDD:285168 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.