DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-14

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001367281.1 Gene:twk-14 / 179699 WormBaseID:WBGene00006669 Length:463 Species:Caenorhabditis elegans


Alignment Length:279 Identity:65/279 - (23%)
Similarity:107/279 - (38%) Gaps:80/279 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   605 AFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCC 669
            :..:|.||::|||:|...|||.|||.:|:.|...|                         ..||.
 Worm   158 SLFFSATVISTIGFGTSTPRTHLGRFITIVYGVVG-------------------------CTCCV 197

  Fly   670 LCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNA 734
            |..|...     :|:......:.|..::.::|         |.:::                 :.
 Worm   198 LFFNLFL-----ERLVTGMSYILRSLRERKIR---------YRLKE-----------------SG 231

  Fly   735 GGPVGSVGGLGDIDSLSASESRGSMHGL--SILAPILLCFSMMIIYIVFGAAVLYRLEKWPILDG 797
            ..||..:....|.:. |:|...|.|...  |:.....:.|||.::.|...|.:...:|.|..:|.
 Worm   232 NKPVTLLLNNEDFNE-SSSSCGGHMDNWRPSVYKVFFILFSMCLVLITASAGIYSVVENWNYIDS 295

  Fly   798 IYFCFMSLSTIGFGD----------MLPGLRRESN---ATTWFCSVYIMSGMTLTAMCFNVIHEE 849
            :||||:|.:||||||          |.|.|.|..|   .|...|..|.:|  .::::....:...
 Worm   296 LYFCFISFATIGFGDYVSNQQDVTRMSPDLYRFVNFCLLTLGACFFYCLS--NVSSIVVRQLLNW 358

  Fly   850 IVHRIRIVVE------FKK 862
            ::.::.:.||      |||
 Worm   359 MIKKMDVKVEDRSFLCFKK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 16/50 (32%)
Ion_trans <601..640 CDD:278921 15/34 (44%)
Ion_trans_2 774..846 CDD:285168 26/84 (31%)
twk-14NP_001367281.1 Ion_trans_2 149..208 CDD:400301 21/79 (27%)
Ion_trans_2 272..353 CDD:400301 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.