powered by:
Protein Alignment CG42537 and CRISPLD2
DIOPT Version :9
| Sequence 1: | NP_001163530.1 |
Gene: | CG42537 / 8674074 |
FlyBaseID: | FBgn0260645 |
Length: | 90 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_113664.1 |
Gene: | CRISPLD2 / 83716 |
HGNCID: | 25248 |
Length: | 497 |
Species: | Homo sapiens |
| Alignment Length: | 120 |
Identity: | 25/120 - (20%) |
| Similarity: | 29/120 - (24%) |
Gaps: | 58/120 - (48%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 23 CDGRPRGRLSCEGGKNEG---------FGGRHCR------------RTAMDEM------------ 54
|:..|:|....|.....| :|| .|| :...|||
Human 198 CNYSPKGNWIGEAPYKNGRPCSECPPSYGG-SCRNNLCYREETYTPKPETDEMNEVETAPIPEEN 261
Fly 55 --W------------------YYNQRTRKCLKMKYLGCGGNQNRYCSLRHCQRSC 89
| |..|..|...|||....|...||| .|...|
Human 262 HVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKGSTCNRY----QCPAGC 312
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG42537 | NP_001163530.1 |
KU |
<53..89 |
CDD:294074 |
14/67 (21%) |
| CRISPLD2 | NP_113664.1 |
SCP_euk |
56..201 |
CDD:240180 |
1/2 (50%) |
| LCCL |
286..370 |
CDD:128866 |
11/31 (35%) |
| LCCL |
387..479 |
CDD:128866 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.