DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42537 and CRISPLD2

Sequence 1:NP_001163530.1 Gene:CG42537 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 HGNCID:25248 Length:497 Species:Homo sapiens

Alignment Length:120 Identity:25/121 (21%)
Similarity:29/121 (24%) Gaps:58/121 (48%)


  Fly    23 CDGRPRGRLSCEGGKNEG---------FGGRHCR------------RTAMDEM------------ 54
            |:..|:|....|.....|         :|| .||            :...|||            
Human   198 CNYSPKGNWIGEAPYKNGRPCSECPPSYGG-SCRNNLCYREETYTPKPETDEMNEVETAPIPEEN 261

  Fly    55 --W------------------YYNQRTRKCLKMKYLGCGGNQNRYCSLRHCQRSC 89
              |                  |..|..|...|||....|...|||    .|...|
Human   262 HVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKGSTCNRY----QCPAGC 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 KU <53..89 CDD:294074 14/68 (21%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 1/3 (33%)
LCCL 286..370 CDD:128866 11/32 (34%)
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.