DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42537 and CG10651

Sequence 1:NP_001163530.1 Gene:CG42537 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster

Alignment Length:45 Identity:8/46 (17%)
Similarity:15/46 (33%) Gaps:17/46 (37%)


  Fly    63 KCL----KMKYLGCGGNQNRYCSLRHC-------------QRSCP 90
            ||:    ...|:...|..:::|....|             :.:||
  Fly     3 KCIWLLFSTLYIQDTGASDKWCKADLCRGQHVLCDDNGNFESTCP 47

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 KU <53..89 CDD:294074 6/43 (14%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.