powered by:
Protein Alignment: CG42537 and scl-20
Sequence 1: | NP_001163530.1 |
Gene: | CG42537 |
FlyBaseID: | FBgn0260645 |
Length: | 90 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_507655.1 |
Gene: | scl-20 |
WormBaseID: | WBGene00013972 |
Length: | 212 |
Species: | Caenorhabditis elegans |
Alignment Length: | 43 |
Identity: | 13/44 (30%) |
Similarity: | 19/44 (43%) |
Gaps: | 10/44 (23%) |
Fly 35 GGKNEGFG--GRHCRRTAMDEMWYYNQRTRKCLKMKYLGCGGN 75
|.||:.|. |.|...|:..:|.:...| ::|||.|
Worm 122 GWKNQEFRMFGDHRLLTSATQMVWATTR--------HVGCGVN 156
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42537 | NP_001163530.1 |
KU |
<53..89 |
CDD:294074 |
6/24 (25%) |
scl-20 | NP_507655.1 |
SCP |
23..177 |
CDD:214553 |
13/44 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
|
|
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
|
|
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.