powered by:
Protein Alignment CG42537 and scl-20
DIOPT Version :9
Sequence 1: | NP_001163530.1 |
Gene: | CG42537 / 8674074 |
FlyBaseID: | FBgn0260645 |
Length: | 90 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_507655.1 |
Gene: | scl-20 / 191309 |
WormBaseID: | WBGene00013972 |
Length: | 212 |
Species: | Caenorhabditis elegans |
Alignment Length: | 43 |
Identity: | 13/43 - (30%) |
Similarity: | 19/43 - (44%) |
Gaps: | 10/43 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 GGKNEGFG--GRHCRRTAMDEMWYYNQRTRKCLKMKYLGCGGN 75
|.||:.|. |.|...|:..:|.:...| ::|||.|
Worm 122 GWKNQEFRMFGDHRLLTSATQMVWATTR--------HVGCGVN 156
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42537 | NP_001163530.1 |
KU |
<53..89 |
CDD:294074 |
6/23 (26%) |
scl-20 | NP_507655.1 |
SCP |
23..177 |
CDD:214553 |
13/43 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.